Analytical Data
-
Gene name
BLOC1S2
- Application
-
Alternative Names
BLOC1S2；BLOS2；CEAP；Biogenesis of lysosome-related organelles complex 1 subunit 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q6QNY1-2
-
Expression Region
2-99aa
-
AA Sequence
FSKMATYLTGELTATSEDYKLLENMNKLTSLKYLEMKDIAINISRNLKDL NQKYAGLQPYLDQINVIEEQVAALEQAAYKLDAYSKKLEAKYKKLEKR
-
Molecular Weight
11 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
BLOC1S2 (Biogenesis of Lysosomal Organelles Complex 1 Subunit 2) is a protein involved in the biogenesis of lysosomes and the trafficking of lysosomal enzymes. It is part of a multi-protein complex that plays a crucial role in maintaining cellular homeostasis and is implicated in the proper functioning of the endosomal-lysosomal system. Research into BLOC1S2 has gained significance due to its association with various genetic disorders, particularly those affecting lysosomal function, such as Hermansky-Pudlak syndrome. Mutations in the BLOC1S2 gene have been linked to impaired pigment cell function and immune system responses, highlighting its importance in cellular integrity and health. Furthermore, understanding the molecular mechanisms underlying BLOC1S2 function could provide insights into therapeutic strategies for lysosomal storage diseases and other disorders related to lysosomal dysfunction. The ongoing investigation into BLOC1S2 not only elucidates its role in cellular processes but also contributes to broader research efforts aimed at unraveling the complexities of organelle biogenesis and disease pathogenesis.
