Analytical Data
-
Gene name
BDNF
- Application
-
Alternative Names
BDNF；Brain-derived neurotrophic factor
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P23560
-
Expression Region
129-247aa
-
AA Sequence
MHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQL KQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIG WRFIRIDTSCVCTLTIKRGR
-
Molecular Weight
27 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Brain-Derived Neurotrophic Factor (BDNF) is a pivotal neurotrophin that plays a crucial role in the growth, maintenance, and survival of neurons. Its function is particularly important in the central nervous system, where it influences synaptic plasticity and cognitive processes such as learning and memory. Dysregulation of BDNF signaling has been implicated in various neurological and psychiatric disorders, including depression, schizophrenia, and neurodegenerative diseases like Alzheimer's. Recent research has focused on the recombinant production of BDNF to understand its mechanisms and therapeutic potential. By engineering recombinant BDNF proteins, scientists aim to dissect its structure-function relationships and explore how modifications can enhance its stability, bioavailability, and efficacy. This line of investigation also opens avenues for developing BDNF-based treatments, either through direct administration or as a part of gene therapy approaches. Understanding the biological effects of BDNF in vivo and in vitro provides valuable insights into its role in neuronal health and its potential as a target for pharmacological intervention, with the ultimate goal of improving outcomes for patients suffering from various neuropsychiatric conditions.
