Analytical Data
-
Gene name
BDH2
- Application
-
Alternative Names
BDH2;DHRS6;SDR15C1;Dehydrogenase/reductase SDR family member 6
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9BUT1
-
Expression Region
1-245aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGRLDGKVIILTAAAQGIGQAAALAFAREG AKVIATDINESKLQELEKYPGIQTRVLDVTKKKQIDQFANEVERLDVLFN VAGFVHHGTVLDCEEKDWDFSMNLNVRSMYLMIKAFLPKMLAQKSGNIIN MSSVASSVKGVVNRCVYSTTKAAVIGLTKSVAADFIQQGIRCNCVCPGTV DTPSLQERIQARGNPEEARNDFLKRQKTGRFATAEEIAMLCVYLASDESA YVTGNPVIIDGGWSL
-
Molecular Weight
29 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
BDH2 (butanediol dehydrogenase 2) is an enzyme that plays a significant role in the metabolic pathways of certain microorganisms, particularly in the conversion of 2,3-butanediol to other compounds. The study of BDH2 and its recombinant protein has garnered attention due to its potential applications in biotechnology and synthetic biology, especially in the production of biofuels and valuable metabolites. Researchers are interested in understanding the enzyme's structure, function, and catalytic mechanisms to optimize its activity for industrial applications. Additionally, BDH2 presents opportunities for genetic engineering approaches to enhance production yields, improve substrate specificity, and reduce by-product formation. Understanding its biochemical properties can lead to insights into the broader metabolic processes in which BDH2 is involved, thereby contributing to advancements in metabolic engineering and bioprocess optimization. The recombinant expression of BDH2 in model organisms allows for the study of its activity in controlled conditions, facilitating the identification of key factors influencing its performance and stability. Furthermore, the analysis of BDH2 can provide valuable information for the design of enzyme variants with tailored properties for specific industrial processes, making it a crucial area of investigation in contemporary biotechnological research.











