Analytical Data
-
Gene name
CT1
- Application
-
Alternative Names
CT1；C20orf28；Sperm flagellar Protein 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q16619
-
Expression Region
2-201aa
-
AA Sequence
SRREGSLEDPQTDSSVSLLPHLEAKIRQTHSLAHLLTKYAEQLLQEYVQL QGDPFGLPSFSPPRLPVAGLSAPAPSHAGLPVHERLRLDAAALAALPPLL DAVCRRQAELNPRAPRLLRRLEDAARQARALGAAVEALLAALGAANRGPR AEPPAATASAASATGVFPAKVLGLRVCGLYREWLSRTEGDLGQLLPGGSA
-
Molecular Weight
21 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CT1, or Cardiotrophin-1, is a member of the interleukin-6 (IL-6) cytokine family, primarily known for its role in cardiac and neuronal functions. Research into CT1 has expanded significantly due to its potential therapeutic implications in cardiovascular diseases, neurodegenerative disorders, and inflammatory conditions. CT1 is produced by various cell types, including cardiac myocytes and astrocytes, and it is involved in several cellular processes, including growth, survival, and differentiation. Studies have shown that CT1 activates signaling pathways such as the Janus kinase/signal transducer and activator of transcription (JAK/STAT) and mitogen-activated protein kinase (MAPK), leading to protective effects in cardiac tissue and the nervous system. The understanding of CT1's mechanism of action and its regulatory role in cellular responses is crucial for developing targeted therapies. Given the increasing prevalence of heart disease and neurodegenerative disorders, research on CT1 and its recombinant forms has garnered interest for both basic and applied sciences, aiming to explore their potential as biomarkers or therapeutic agents. These studies promise to offer insights that could enhance our understanding of disease mechanisms and lead to innovative treatment strategies.
