Cat: PA1000-317DB

Recombinant Human BDH1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    BDH1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    BDH1;BDH;SDR9C1;D-beta-hydroxybutyrate dehydrogenase. mitochondrial

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q02338

  • Expression Region

    1-343aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMLATRLSRPLSRLPGKTLSACDRENGARRP LLLGSTSFIPIGRRTYASAAEPVGSKAVLVTGCDSGFGFALAKHLHSKGF LVFAGCLMKDKGHDGVKELDSLNSDRLRTVQLNVCSSEEVEKVVEIVRSS LKDPEKGMWGLVNNAGISTFGEVEFTSLETYKQVAEVNLWGTVRMTKSFL PLIRRAKGRVVNISSMLGRMANPARSPYCITKFGVEAFSDCLRYEMYPLG VKVSVVEPGNFIAATSLYSPESIQAIAKKMWEELPEVVRKDYGKKYFDEK IAKMETYCSSGSTDTSPVIDAVTHALTATTPYTRYHPMDYYWWLRMQIMT HLPGAISDMIYIR

  • Molecular Weight

    40 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

BDH1 (butyric acid dehydrogenase 1) is an enzyme that plays a crucial role in the metabolism of butyrate and other short-chain fatty acids, which are significant for maintaining gut health and overall metabolic functions. The study of BDH1 has gained momentum due to its potential implications in various diseases, including metabolic disorders, cancer, and inflammatory bowel diseases. Research has demonstrated that BDH1 is involved in cellular signaling pathways and can influence the energy homeostasis of cells. Furthermore, the manipulation of BDH1 activity presents new avenues for therapeutic strategies, especially in conditions characterized by dysregulated energy metabolism. Recombinant BDH1 protein generation allows for a deeper understanding of its biochemical properties and functional roles in various physiological contexts. This research not only aims to elucidate the enzyme's mechanism of action but also to explore its potential as a biomarker for disease progression and as a target for innovative treatment options. As the scientific community progresses in the characterization and application of BDH1, it is anticipated that findings will contribute significantly to the development of novel interventions and enhance our comprehension of its broader impact on human health.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US