Analytical Data
-
Gene name
ADORA2b
- Application
-
Alternative Names
ADORA2b；Adenosine receptor A2b
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P29275
-
Expression Region
1-332aa
-
AA Sequence
MLLETQDALYVALELVIAALSVAGNVLVCAAVGTANTLQTPTNYFLVSLAAADVAVGLFAIPFAITISLGFCTDFYGCLFLACFVLVLTQSSIFSLLAVAVDRYLAICVPLRYKSLVTGTRARGVIAVLWVLAFGIGLTPFLGWNSKDSATNNCTEPWDGTTNESCCLVKCLFENVVPMSYMVYFNFFGCVLPPLLIMLVIYIKIFLVACRQLQRTELMDHSRTTLQREIHAAKSLAMIVGIFALCWLPVHAVNCVTLFQPAQGKNKPKWAMNMAILLSHANSVVNPIVYAYRNRDFRYTFHKIISRYLLCQADVKSGNGQAGVQPALGVGL
-
Molecular Weight
36.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ADORA2B, a subtype of the adenosine receptor family, plays a crucial role in various physiological processes, including immune response, inflammation, and cardioprotection. Research on ADORA2B has gained momentum due to its potential therapeutic implications in treating diseases such as heart failure, asthma, and cancer. This receptor is known to mediate its effects through the activation of intracellular signaling pathways, primarily involving cyclic AMP (cAMP) and mitogen-activated protein kinase (MAPK) cascades. Recombinant protein technology has emerged as a powerful tool to study ADORA2B, allowing for the production of purified receptor proteins that can be utilized in binding assays, structural analyses, and functional studies. Understanding the molecular mechanisms through which ADORA2B exerts its effects can lead to the identification of new drug targets and insights into the development of adenosine-based therapies. With advances in biotechnology, research continues to focus on characterizing the receptor’s structure-function relationship, pharmacological profiles, and its role in pathophysiological contexts, thereby contributing to the broader field of G protein-coupled receptor research.
