Analytical Data
-
Gene name
ACP
- Application
-
Alternative Names
ACP；3-oxoacyl-[acyl-carrier-Protein] synthase. mitochondrial
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P0A6A8
-
Expression Region
1-78aa
-
AA Sequence
MSTIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEAEKITTVQAAIDYINGHQA
-
Molecular Weight
8.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The study of ACP (Acyl Carrier Protein) recombinant proteins has gained significant attention in recent years due to their critical role in fatty acid biosynthesis and metabolism across various organisms. ACP acts as a pivotal carrier for acyl groups during the synthesis of fatty acids, phospholipids, and other lipid-derived compounds, making it essential for cellular functions, membrane integrity, and energy storage. Understanding the structure and function of ACP is crucial, as alterations in its activity can lead to metabolic disorders and affect the overall lipid profile of cells. The recombinant production of ACP allows researchers to investigate its biochemical properties, interactions with enzymes, and its integration into metabolic pathways in a controlled environment. This approach not only aids in elucidating the fundamental mechanisms of lipid metabolism but also fosters the development of biotechnological applications, such as engineering microbial strains for enhanced lipid production. The insights gained from ACP recombinant protein studies promise to contribute to biomedicine, agriculture, and synthetic biology, paving the way for novel strategies in health and nutrition.
