Analytical Data
-
Gene name
MFRN
- Application
-
Alternative Names
MFRN;MFRN;MSCP;Mitoferrin-1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9NYZ2
-
Expression Region
1-338aa
-
AA Sequence
MELRSGSVGSQAVARRMDGDSRDGGGGKDATGSEDYENLPTSASVSTHMTAGAMAGILEHSVMYPVDSVKTRMQSLSPDPKAQYTSIYGALKKIMRTEGFWRPLRGVNVMIMGAGPAHAMYFACYENMKRTLNDVFHHQGNSHLANGIAGSMATLLHDAVMNPAEVVKQRLQMYNSQHRSAISCIRTVWRTEGLGAFYRSYTTQLTMNIPFQSIHFITYEFLQEQVNPHRTYNPQSHIISGGLAGALAAAATTPLDVCKTLLNTQENVALSLANISGRLSGMANAFRTVYQLNGLAGYFKGIQARVIYQMPSTAISWSVYEFFKYFLTKRQLENRAPY
-
Molecular Weight
37.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MFRN (Mitochondrial Ferritin) is a mitochondrial protein known for its role in iron metabolism and cellular protection against oxidative stress. The study of MFRN has gained significant attention due to its potential implications in understanding diseases related to iron dysregulation, such as neurodegenerative disorders and certain types of cancer. MFRN is unique in that it can sequester iron within mitochondria, thus playing a crucial role in maintaining mitochondrial function and integrity. As iron overload can lead to the production of harmful reactive oxygen species (ROS), the expression and regulation of MFRN are essential for cellular homeostasis. Recent studies have uncovered its involvement in various signaling pathways that influence mitochondrial dynamics and the cellular response to oxidative damage. Furthermore, the exploration of MFRN as a therapeutic target holds promise for developing innovative strategies to mitigate diseases linked to iron imbalances. Advances in recombinant protein technology have enabled the production of MFRN for biochemical studies, facilitating a deeper understanding of its structural and functional properties. This research is pivotal to elucidating the mechanisms by which MFRN contributes to cellular health and disease, ultimately providing insights that could inform therapeutic interventions.











