Cat: PA1000-284DB

Recombinant Human B3GAT3 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    B3GAT3

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    B3GAT3;GalactosylgalactosylxylosylProtein 3-beta-glucuronosyltransferase 3

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O94766

  • Expression Region

    29-335aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGSQPCDCLPPLRAAAEQLRQKDLRISQLQ AELRRPPPAPAQPPEPEALPTIYVVTPTYARLVQKAELVRLSQTLSLVPR LHWLLVEDAEGPTPLVSGLLAASGLLFTHLVVLTPKAQRLREGEPGWVHP RGVEQRNKALDWLRGRGGAVGGEKDPPPPGTQGVVYFADDDNTYSRELFE EMRWTRGVSV WPVGLVGGLR FEGPQVQDGRVVGFHTAWEPSRPFPVDMAGFAVALPLLLDKPNAQFDSTA PRGHLESSLLSHLVDPKDLEPRAANCTRVLVWHTRTEKPKMKQEEQLQRQ GRGSDPAIEV

  • Molecular Weight

    36 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

B3GAT3, or Beta-1,3-glucuronyltransferase 3, is a significant enzyme that plays a crucial role in glycosaminoglycan (GAG) biosynthesis, specifically in the synthesis of heparan sulfate and related polysaccharides. Alterations in B3GAT3 function have been implicated in various developmental and pathological conditions, including congenital disorders and cancers. The enzyme catalyzes the attachment of glucuronic acid to glycoproteins and proteoglycans, influencing cellular interactions, signaling pathways, and extracellular matrix composition. Research on B3GAT3 has expanded in recent years, uncovering its involvement in modulating cellular processes such as proliferation, differentiation, and migration. Understanding the regulation and mechanism of B3GAT3 could provide insights into therapeutic approaches for diseases characterized by GAG imbalances. Additionally, the study of this enzyme offers potential applications in regenerative medicine and tissue engineering, where the modulation of glycosylation patterns is crucial for the development of functional biomaterials. Despite its physiological significance, the molecular pathways and regulatory networks involving B3GAT3 remain poorly understood, warranting further investigation to elucidate its overall role in health and disease.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US