Cat: PA1000-282DB

Recombinant Human AZGP1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    AZGP1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    AZGP1;ZAG;ZNGP1;Zinc-alpha-2-glycoProtein

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P25311

  • Expression Region

    22-298aa

  • AA Sequence

    ENQGGRYSLTYIYTGLSKHVEDVPAFQALGSLNDLQFFRYNSKDRKSQPM GLWRQVEGMEDWKQDSQLQKAREDIFMETLKDIVEYYNDSNGSHVLQGRF GCEIENNRSSGAFWKYYYDGKDYIEFNKEIPAWVPFDPAAQITKQKWEAE PVYVQRAKAYLEEECPATLRKYLKYSKNILDRQDPPSVVVTSHQAPGEKK KLKCLAYDFYPGKIDVHWTRAGEVQEPELRGDVLHNGNGTYQSWVVVAVP PQDTAPYSCHVQHSSLAQPLVGPWEAS

  • Molecular Weight

    56 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

AZGP1 (alpha-2-glycoprotein 1, zinc-binding) is a glycoprotein that has garnered attention in scientific research due to its potential roles in various physiological and pathological processes. Initially identified as a protein that binds zinc, AZGP1 is predominantly expressed in adipose tissue and is implicated in lipid metabolism and energy regulation. Its expression levels are often altered in conditions such as obesity, diabetes, and cancer, leading to investigations into its functional significance. Researchers have discovered that AZGP1 may influence insulin sensitivity and adipocyte differentiation, suggesting its involvement in metabolic disorders. Additionally, studies have explored its potential as a biomarker for certain cancers, given its differential expression in tumor versus normal tissues. The recombinant production of AZGP1 has facilitated detailed biochemical and structural studies, allowing for a better understanding of its interactions and mechanisms of action. This research is crucial for developing therapeutic strategies targeting AZGP1 in metabolic diseases and cancer treatment, highlighting its importance in both basic and translational biomedical research. 

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US