Analytical Data
-
Gene name
CCND3
- Application
-
Alternative Names
CCND3;G1/S-specific cyclin-D3
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P30281
-
Expression Region
1-292aa
-
AA Sequence
MELLCCEGTRHAPRAGPDPRLLGDQRVLQSLLRLEERYVPRASYFQCVQREIKPHMRKMLAYWMLEVCEEQRCEEEVFPLAMNYLDRYLSCVPTRKAQLQLLGAVCMLLASKLRETTPLTIEKLCIYTDHAVSPRQLRDWEVLVLGKLKWDLAAVIAHDFLAFILHRLSLPRDRQALVKKHAQTFLALCATDYTFAMYPPSMIATGSIGAAVQGLGACSMSGDELTELLAGITGTEVDCLRACQEQIEAALRESLREASQTSSSPAPKAPRGSSSQGPSQTSTPTDVTAIHL
-
Molecular Weight
80.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Cyclin D3 (CCND3) is a member of the cyclin family of proteins that play a crucial role in regulating the cell cycle, particularly the progression from G1 phase to S phase. Dysregulation of CCND3 has been implicated in various cancers, making it a potential target for therapeutic intervention. In recent years, researchers have focused on the construction of recombinant CCND3 proteins to study its structure, function, and interactions with cyclin-dependent kinases (CDKs). This recombinant approach allows for a detailed examination of the biochemical properties of CCND3, including its role in cell cycle regulation and its impact on tumorigenesis. Additionally, recombinant CCND3 can be used to identify small molecule inhibitors and other therapeutic agents that can modulate its activity. Understanding CCND3's function at a molecular level is essential for developing targeted therapies that could inhibit its dysregulation in cancer and other diseases. Consequently, the study of CCND3 as a recombinant protein not only enhances our knowledge of cell cycle dynamics but also holds promise for novel cancer treatments.











