Analytical Data
-
Gene name
ARPC5
- Application
-
Alternative Names
ARPC5；ARC16；Actin-related Protein 2/3 complex subunit 5
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O15511
-
Expression Region
1-154aa
-
AA Sequence
MSKNTVSSARFRKVDVDEYDENKFVDEEDGGDGQAGPDEGEVDSCLRHSITGNMTAALQAALKNPPINTKSQAVKDRAGSIVLKVLISFKANDIEKAVQSLDKNGVDLLMKYIYKGFESPSDNSSAMLLQWHEKALAAGGVGSIVRVLTARKTV
-
Molecular Weight
43.6kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ARPC5, or Actin-related protein 2/3 complex subunit 5, is a crucial component of the Arp2/3 complex, which plays a pivotal role in the regulation of actin cytoskeleton dynamics. The actin cytoskeleton is essential for various cellular processes such as motility, division, and intracellular transport. Recent studies highlight the significance of ARPC5 in various biological contexts, including cell migration, cancer metastasis, and immune responses. Alterations in ARPC5 expression and function have been implicated in several diseases, making it a potential target for therapeutic interventions. Research into ARPC5 recombinant proteins has gained momentum as scientists aim to elucidate its structure-function relationships and interactions with other cytoskeletal components. By expressing ARPC5 in recombinant systems, researchers can produce large quantities of the protein for biochemical assays, structural studies, and functional analyses. Understanding the precise role of ARPC5 in the context of the Arp2/3 complex and its broader implications in cellular physiology and pathology could provide insights into novel strategies for disease prevention and treatment.
