Cat: PA1000-9027

Recombinant Human CYP24A1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CYP24A1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    CYP24A1;CYP24;1.25-dihydroxyvitamin D(3) 24-hydroxylase. mitochondrial

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q07973

  • Expression Region

    415-514aa

  • AA Sequence

    LMLNTQVLGSSEDNFEDSSQFRPERWLQEKEKINPFAHLPFGVGKRMCIG RRLAELQLHLALCWIVRKYDIQATDNEPVEMLHSGTLVPSRELPIAFCQR

  • Molecular Weight

    37 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CYP24A1 (cytochrome P450 24A1) is an enzyme that plays a crucial role in the metabolism of vitamin D. It is primarily responsible for the catabolism of active vitamin D metabolites, particularly 1,25-dihydroxyvitamin D3, into biologically inactive forms. Dysregulation of CYP24A1 activity has been linked to various health issues, including vitamin D deficiency and related diseases such as osteoporosis, autoimmune disorders, and certain cancers. Given its importance in vitamin D signaling and homeostasis, research on CYP24A1 has garnered significant attention. Recombinant CYP24A1 proteins are vital tools for elucidating the enzyme's structure-function relationships, inhibition mechanisms, and interactions with other proteins. The production of these proteins in a laboratory setting allows for detailed biochemical studies and the development of potential therapeutic agents targeting vitamin D metabolic pathways. Moreover, understanding CYP24A1's role could lead to novel strategies for managing vitamin D-related disorders, emphasizing the need for continued investigation into its enzymatic properties and regulatory mechanisms.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US