Analytical Data
-
Gene name
CYP24A1
- Application
-
Alternative Names
CYP24A1；CYP24；1.25-dihydroxyvitamin D(3) 24-hydroxylase. mitochondrial
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q07973
-
Expression Region
415-514aa
-
AA Sequence
LMLNTQVLGSSEDNFEDSSQFRPERWLQEKEKINPFAHLPFGVGKRMCIG RRLAELQLHLALCWIVRKYDIQATDNEPVEMLHSGTLVPSRELPIAFCQR
-
Molecular Weight
37 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CYP24A1 (cytochrome P450 24A1) is an enzyme that plays a crucial role in the metabolism of vitamin D. It is primarily responsible for the catabolism of active vitamin D metabolites, particularly 1,25-dihydroxyvitamin D3, into biologically inactive forms. Dysregulation of CYP24A1 activity has been linked to various health issues, including vitamin D deficiency and related diseases such as osteoporosis, autoimmune disorders, and certain cancers. Given its importance in vitamin D signaling and homeostasis, research on CYP24A1 has garnered significant attention. Recombinant CYP24A1 proteins are vital tools for elucidating the enzyme's structure-function relationships, inhibition mechanisms, and interactions with other proteins. The production of these proteins in a laboratory setting allows for detailed biochemical studies and the development of potential therapeutic agents targeting vitamin D metabolic pathways. Moreover, understanding CYP24A1's role could lead to novel strategies for managing vitamin D-related disorders, emphasizing the need for continued investigation into its enzymatic properties and regulatory mechanisms.
