Cat: PA1000-226DB

Recombinant Human ARL4D Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    ARL4D

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    ARL4D;ARF4L;ADP-ribosylation factor-like Protein 4D

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P49703

  • Expression Region

    1-201aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGNHLTEMAPTASSFLPHFQALHVVVIGLD SAGKTSLLYRLKFKEFVQ SVPTKGFNTEKIRVPLGGSRGITFQVWDVG GQEKLRPLWRSYTRRTDGLVFVVDAAEAERLEEAKVELHRISRAS DNQ GVPVLVLANKQDQPGALSAAEVEKRLAVRELAAATLTHVQGCSAVDGLGL QQGLERLYEMILKRKKAARGGK KRR

  • Molecular Weight

    24 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

ARL4D, or ADP-ribosylation factor-like 4D, is a member of the ARF protein family, which plays a critical role in various cellular processes including membrane trafficking, cytoskeletal dynamics, and signal transduction. Its specific involvement in processes such as cell proliferation, migration, and differentiation has positioned ARL4D as a significant focus in cancer research, particularly concerning its potential role in tumorigenesis and metastasis. Given its unique structural features and regulatory functions, researchers have shown increasing interest in understanding the molecular mechanisms underpinning ARL4D's activity. The recombinant expression of ARL4D protein is a pivotal step towards elucidating its biological functions and interactions. By producing a purified form of ARL4D, scientists can employ various biochemical and biophysical techniques to analyze its domain structure, binding partners, and downstream effects on cellular signaling pathways. Such investigations may reveal novel therapeutic targets for cancer treatment and provide insight into the general mechanisms of cell regulation. Therefore, the study of ARL4D recombinant proteins not only enhances our basic understanding of ARF family proteins but also holds promise for advancing biomedical research related to cellular growth and cancer biology.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US