Analytical Data
-
Gene name
COX4I1
- Application
-
Alternative Names
COX4I1；COX4；Cytochrome c oxidase subunit 4 isoform 1. mitochondrial
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P13073
-
Expression Region
23-169aa
-
AA Sequence
AHESVVKSEDFSLPAYMDRRDHPLPEVAHVKHLSASQKALKEKEKASWSSLSMDEKVELYRIKFKESFAEMNRGSNEWKTVVGGAMFFIGFTALVIMWQKHYVYGPLPQSFDKEWVAKQTKRMLDMKVNPIQGLASKWDYEKNEWKK
-
Molecular Weight
33.2kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
COX4I1, or cytochrome c oxidase subunit 4 isoform 1, plays a crucial role in the assembly and function of cytochrome c oxidase (CCO), the terminal enzyme complex of the mitochondrial electron transport chain. This enzyme is pivotal in cellular respiration, facilitating the reduction of oxygen to water while contributing to ATP production through oxidative phosphorylation. Research on COX4I1 is particularly significant due to its implications in various physiological and pathological conditions, including metabolic diseases, neurodegenerative disorders, and cancer. Alterations in COX4I1 expression or function can lead to mitochondrial dysfunction, which is a common hallmark of these diseases. Several studies have investigated the regulatory mechanisms and pathways that control COX4I1 expression, emphasizing its potential as a biomarker for mitochondrial health and as a therapeutic target. Furthermore, the development of recombinant COX4I1 proteins has enabled deeper investigations into its structural and functional properties, allowing scientists to explore its role in the assembly of the CCO complex and its interactions with other mitochondrial proteins. This research provides a valuable foundation for understanding the broader implications of mitochondrial dynamics in health and disease.
