Analytical Data
-
Gene name
ARL4A
- Application
-
Alternative Names
ARL4A；ARL4；ADP-ribosylation factor-like Protein 4A
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P40617
-
Expression Region
1-200aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGNGLSDQTSILSNLPSFQSFHIVILGLDC AGKTTVLYRLQFNEFVNTVPTKGFNTEKIKVTLGNSKTVTFHFWDVGGQE KLRPLWKSYTRCTDGIVFVVDSVDVERMEEAKTELHKITRISENQGVPVL IVANKQDLRNSLSLSEIEKLLAMGELSSSTPWHLQPTCAIIGDGLKEGLE KLHDMIIKRRKMLRQQKKKR
-
Molecular Weight
25 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ARL4A (ADP-ribosylation factor-like 4A) is a member of the ARF family of small GTPases, which play a crucial role in regulating various cellular processes such as vesicle trafficking, cytoskeletal dynamics, and cell signaling. Recent studies have highlighted the importance of ARL4A in various physiological and pathological contexts, including cancer, where its overexpression has been associated with enhanced cell proliferation and metastasis. The protein is also implicated in the regulation of gene expression and cellular responses to stress. Given its emerging roles in cellular homeostasis and disease progression, there is a growing interest in characterizing the biochemical properties and functional mechanisms of ARL4A. Researchers are focusing on the structural analysis of ARL4A, investigating its interactions with downstream effectors and identifying potential regulatory pathways. The production of recombinant ARL4A protein is critical for these studies, enabling in vitro assays to assess its activity and interactions. Understanding the dynamics of ARL4A could offer new insights into therapeutic targets for diseases where ARL4A is dysregulated. This research not only enhances our knowledge of ARF family proteins but also sets the stage for the development of novel strategies to modulate ARL4A-related pathways in various diseases.
