Cat: PA1000-9019

Recombinant Human CYCS Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CYCS

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    CYCS;CYC;Cytochrome c

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P99999

  • Expression Region

    1-105aa

  • AA Sequence

    MGDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYT AANKNKGIIWGEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLK KATNE

  • Molecular Weight

    37 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

The study of CYCS (cytochrome c, somatic) recombinant protein is rooted in its significant role in cellular respiration and apoptosis. As a mitochondrial protein, CYCS serves as a crucial electron carrier in the mitochondrial electron transport chain, facilitating ATP production through oxidative phosphorylation. Additionally, CYCS is intricately involved in programmed cell death, where it functions as a pro-apoptotic factor, promoting apoptosome formation and initiating caspase activation. Dysregulation of CYCS expression or function is associated with various diseases, including cancer and neurodegenerative disorders, underscoring its importance as a potential therapeutic target. The production of recombinant CYCS allows for extensive studies of its biochemical properties, interactions, and functional mechanisms, enabling researchers to elucidate its role in both healthy and diseased states. Advanced techniques in protein expression and purification facilitate the investigation of mutant forms of CYCS, providing insight into pathophysiological processes. Moreover, recombinant CYCS can be used in drug screening assays and as a model for understanding mitochondrial dysfunction, further emphasizing its relevance in biomedical research. Therefore, the exploration of CYCS recombinant protein represents a vital area of study with implications for understanding fundamental biological processes and developing novel therapeutic strategies.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US