Analytical Data
-
Gene name
ARL2BP
- Application
-
Alternative Names
ARL2BP；BART；BART1；ADP-ribosylation factor-like Protein 2-binding Protein
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9Y2Y0
-
Expression Region
1-163aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMDALEGESFALSFSSASDAEFDAVVGYLED IIMDDEFQLLQRNFMDKYYLEFEDTEENKLIYTPIFNEYISLVEKYIEEQ LLQRIPEFNMAAFTTTLQHHKDEVAGDIFDMLLTFTDFLAFKEMFLDYRA EKEGRGLDLSSGLVVTSLCKSSSLPASQNNLRH
-
Molecular Weight
21 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ARL2BP (ADP-ribosylation factor-like 2 binding protein) is an important protein that plays a crucial role in intracellular transport and membrane dynamics. It has been implicated in various cellular processes, including endocytosis, exocytosis, and cytoskeletal organization. The study of ARL2BP is particularly relevant due to its association with several diseases, including cancer, where it may affect cell proliferation and migration. Research has shown that ARL2BP interacts with proteins involved in the regulation of the actin cytoskeleton and microtubule dynamics, suggesting that it is a key player in maintaining cellular morphology and function. Recombinant ARL2BP proteins are essential for elucidating its structure-function relationship, as they provide valuable insights into its binding mechanisms and subsequent cellular roles. Additionally, investigating ARL2BP's interactions with other cellular components can help to uncover its potential as a therapeutic target. Overall, the exploration of ARL2BP through recombinant protein studies is vital for understanding its biological significance and potential contributions to pathophysiology.
