Cat: PA1000-222DB

Recombinant Human ARL2 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    ARL2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    ARL2;ADP-ribosylation factor-like Protein 2

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P36404

  • Expression Region

    1-184aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGLLTILKKMKQKERELRLLMLGLDNAGKT TILKKFNGEDIDTISPTLGFNIKTLEHRGFKLNIWDVGGQKSLRSYWRNY FESTDGLIWVVDSADRQRMQDCQRELQSLLVEERLAGATLLIFANKQDLP GALSSNAIREALELDSIRSHHWCIQGCSAVTGENLLPGIDWLLDDISSRI FTAD

  • Molecular Weight

    23 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

ARL2 (ADP-ribosylation factor-like 2) is a member of the ARF (ADP-ribosylation factor) family of small GTPases, which play a crucial role in various cellular processes, including membrane trafficking, cytoskeletal dynamics, and signal transduction. Research on ARL2 has gained momentum due to its involvement in essential cellular functions and potential implications in disease mechanisms, including cancer. The protein is known to regulate microtubule dynamics and interact with various cellular partners, influencing cellular morphology and migration. Additionally, ARL2 has been implicated in the regulation of cilia and flagella assembly, further underscoring its significance in maintaining cellular homeostasis. Investigating the structure and function of recombinant ARL2 protein provides critical insights into its biological roles and regulatory mechanisms. By understanding the specific interactions and pathways affected by ARL2, researchers aim to uncover novel therapeutic targets for diseases associated with its dysregulation. The development of recombinant ARL2 protein allows for detailed biochemical and biophysical studies, contributing to a more comprehensive understanding of its functional repertoire in health and disease contexts.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US