Analytical Data
-
Gene name
ICAM4
- Application
-
Alternative Names
ICAM4；LW；Intercellular adhesion molecule 4
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9BWR0
-
Expression Region
43-210aa
-
AA Sequence
GTSVPFWVRMSPEFVAVQPGKSVQLNCSNSCPQPQNSSLRTPLRQGKTLRGPGWVSYQLLDVRAWSSLAHCLVTCAGKTRWATSRITAYKPPHSVILEPPVLKGRKYTLRCHVTQVFPVGYLVVTLRHGSRVIYSESLERFTGLDLANVTLTYEFAAGPRDFWQPVIC
-
Molecular Weight
18 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The study of the ICAM4 (Intercellular Adhesion Molecule 4) recombinant protein has garnered significant attention in the context of immunology and vascular biology due to its crucial role in cell adhesion and immune responses. ICAM4 is primarily expressed on erythrocytes and endothelial cells, where it serves as a ligand for leukocyte adhesion, facilitating the migration of immune cells to sites of inflammation and injury. Understanding the structure and function of the ICAM4 protein is vital for elucidating its involvement in various pathological conditions, including autoimmune disorders, cardiovascular diseases, and cancer metastasis. The recombinant production of ICAM4 allows researchers to investigate its biological functions in controlled experimental settings and to explore its potential as a therapeutic target. Moreover, studying ICAM4 can provide insights into the mechanisms of cell signaling and the inflammatory response. The ability to produce ICAM4 as a recombinant protein has opened avenues for structural analysis, which may lead to the development of novel approaches to modulate its activity. As such, research on ICAM4 not only contributes to basic science but also has important implications for the development of new therapeutic strategies in treating diseases associated with aberrant cell adhesion and immune responses.
