Cat: PA1000-168DB

Recombinant Human ANXA4 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    ANXA4

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    ANXA4;ANX4;Annexin A4

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P09525

  • Expression Region

    578-942aa

  • AA Sequence

    SSPIQESTAPELPSETQETPGPALCSPLRKSPLTLEDFKFLAVLGRGHFG KVLLSEFRPSGELFAIKALKKGDIVARDEVESLMCEKRILAAVTSAGHPF LVNLFGCFQTPEHVCFVMEYSAGGDLMLHIHSDVFSEPRAIFYSACVVLG LQFLHEHKIVYRDLKLDNLLLDTEGYVKIADFGLCKEGMGYGDRTSTFCG TPEFLAPEVLTDTSYTRAVDWWGLGVLLYEMLVGESPFPGDDEEEVFDSI VNDEVRYPRFLSAEAIGIMRRLLRRNPERRLGSSERDAEDVKKQPFFRTL GWEALLARRLPPPFVPTLSGRTDVSNFDEEFTGEAPTLSPPRDARPLTAA EQAAFLDFDFVAGGC

  • Molecular Weight

    72 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

ANXA4, or Annexin A4, is a member of the annexin family of calcium-dependent phospholipid-binding proteins, which play crucial roles in various cellular processes, including membrane repair, inflammation, and apoptosis. Research has increasingly focused on ANXA4 due to its implications in several pathophysiological conditions, particularly cancer. Elevated expression levels of ANXA4 have been associated with tumor growth, metastasis, and poor prognosis in various malignancies, such as breast and prostate cancer. This has prompted interest in understanding the molecular mechanisms underlying ANXA4’s role in tumor biology. Recombining ANXA4 protein allows researchers to study its functions more intricately, investigate its interactions with other cellular components, and evaluate its potential as a biomarker or therapeutic target. Additionally, the characterization of recombinant ANXA4 facilitates the exploration of its structural and functional properties, providing insights into how this protein may influence cellular signaling pathways and contribute to disease progression. Overall, the study of recombinant ANXA4 protein holds promise for advancing our understanding of its biological significance and therapeutic potential in oncology and other diseases.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US