Analytical Data
-
Gene name
CDX2
- Application
-
Alternative Names
CDX2；CDX3；Homeobox Protein CDX-2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q99626
-
Expression Region
1-313aa
-
AA Sequence
MYVSYLLDKDVSMYPSSVRHSGGLNLAPQNFVSPPQYPDYGGYHVAAAAA AAANLDSAQSPGPSWPAAYGAPLREDWNGYAPGGAAAAANAVAHGPNGGS PAAAMGYSSPADYHPHHHPHHHPHHPAAAPSCASGLLQTLNPGPPGPAAT AAAEQLSPGGQRRNLCEWMRKPAQQSLGSQVKTRTKDKYRVVYTDHQRLE LEKEFHYSRYITIRRKAELAATLGLSERQVKIWFQNRRAKERKINKKKLQ QQQQQQPPQPPPPPPQPPQPQPGPLRSVPEPLSPVSSLQASVSGSVPGVL GPTGGVLNPTVTQ
-
Molecular Weight
61 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CDX2 is a crucial transcription factor that plays a significant role in the development and differentiation of intestinal epithelium. It is primarily expressed in intestinal tissues and is essential for maintaining the integrity and functionality of the gastrointestinal tract. Changes in CDX2 expression are often associated with various gastrointestinal disorders, including colorectal cancer and inflammatory bowel disease. The study of CDX2 recombinant protein has gained attention in recent years due to its potential applications in both basic research and clinical settings. By generating recombinant CDX2 protein, researchers can investigate its role in gene regulation, cellular signaling pathways, and the mechanisms underlying intestinal development and homeostasis. Furthermore, understanding CDX2's interaction with other proteins can provide insights into the molecular changes that occur in intestinal diseases. The use of CDX2 recombinant protein also opens avenues for the development of novel therapeutic strategies that target CDX2-related pathways, making it a promising focus of research in gastroenterology and cancer biology. Overall, the exploration of CDX2 recombinant protein serves not only to enhance our understanding of intestinal biology but also to contribute to the development of innovative approaches for the diagnosis and treatment of intestinal diseases.
