Cat: PA1000-159DB

Recombinant Human ANGPTL2 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    ANGPTL2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    ANGPTL2;ARP2;Angiopoietin-related Protein 2

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9H1Y8

  • Expression Region

    23-493aa

  • AA Sequence

    MKHHHHHHASQEDGFEGTEEGSPREFIYLNRYKRAGESQDKCTYTFIVPQ QRVTGAICVNSKEPEVLLENRVHKQELELLNNELLKQKRQIETLQQLVEV DGGIVSEVKLLRKESRNMNSRVTQLYMQLLHEIIRKRDNALELSQLENRI LNQTADMLQLASKYKDLEHKYQHLATLAHNQSEIIAQLEEHCQRVPSARP VPQPPPAAPPRVYQPPTYNRIINQISTNEIQSDQNLKVLPPPLPTMPTLT SLPSSTDKPSGPWRDCLQALEDGHDTSSIYLVKPENTNRLMQVWCDQRHD PGGWTVIQRRLDGSVNFFRNWETYKQGFGNIDGEYWLGLENIYWLTNQGN YKLLVTMEDWSGRKVFAEYASFRLEPESEYYKLRLGRYHGNAGDSFTWHN GKQFTTLDRDHDVYTGNCAHYQKGGWWYNACAHSNLNGVWYRGGHYRSRY QDGVYWAEFRGGSYSLKKVVMMIRPNPNTFH

  • Molecular Weight

    58 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

ANGPTL2, or Angiopoietin-like protein 2, is a secreted protein that plays a significant role in various physiological and pathological processes, including inflammation, obesity, and cardiovascular diseases. Initially identified as a protein involved in angiogenesis, ANGPTL2 has been linked to metabolic disorders and insulin resistance, making it a crucial target for research in diabetes and related conditions. Studies have shown that elevated levels of ANGPTL2 correlate with adverse metabolic profiles and inflammatory responses. As a result, the recombinant protein has become a focus of investigation for its potential as a therapeutic target and biomarker. Researchers have been exploring ways to produce and characterize recombinant ANGPTL2 to better understand its mechanisms of action and interaction with other cellular pathways. This research aims to elucidate the role of ANGPTL2 in disease processes and to evaluate its suitability as a target for new therapeutic strategies aimed at mitigating metabolic diseases and their complications. By leveraging advances in recombinant DNA technology and protein expression systems, scientists are working towards a deeper understanding of ANGPTL2's biological functions and its implications in human health.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US