Cat: PA1000-158DB

Recombinant Human ANGPT1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    ANGPT1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    ANGPT1;KIAA0003;Angiopoietin-1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q15389

  • Expression Region

    1-480aa

  • AA Sequence

    MSNQRRSPENSGRRYNRIQHGQCAYTFILPEHDGNCRESTTDQYNTNALQ RDAPHVEPDFSSQKLQHLEHVMENYTQWLQKLENYIVENMKSEMAQIQQN AVQNHTATMLEIGTSLLSQTAEQTRKLTDVETQVLNQTSRLEIQLLENSL STYKLEKQLLQQTNEILKIHEKNSLLEHKILEMEGKHKEELDTLKEEKEN LQGLVTRQTYIIQELEKQLNRATTNNSVLQKQQLELMDTVHNLVNLCTKE GVLLKGGKREEEKPFRDCADVYQAGFNKSGIYTIYINNMPEPKKVFCNMD VNGGGWTVIQHREDGSLDFQRGWKEYKMGFGNPSGEYWLGNEFIFAITSQ RQYMLRIELMDWEGNRAYSQYDRFHIGNEKQNYRLYLKGHTGTAGKQSSL ILHGADFSTKDADNDNCMCKCALMLTGGWWFDACGPSNLNGMFYTAGQNH GKLNGIKWHYFKGPSYSLRSTTMMIRPLDF

  • Molecular Weight

    56 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

ANGPT1 (Angiopoietin-1) is a key regulator of angiogenesis and vascular integrity, playing an essential role in blood vessel formation and stabilization. It functions primarily by binding to the Tie2 receptor on endothelial cells, promoting their survival and enhancing the junctions between them, which is crucial for maintaining vascular permeability. Dysregulation of ANGPT1 signaling has been implicated in various pathologies, including cancer, where angiogenesis is often upregulated, and cardiovascular diseases characterized by vascular instability. Research into recombinant ANGPT1 protein has gained momentum due to its potential therapeutic applications. By producing ANGPT1 through recombinant DNA techniques, scientists can investigate its effects in controlled environments, explore its mechanisms of action, and evaluate its efficacy in treating conditions associated with aberrant angiogenesis. Furthermore, ANGPT1 is being studied for its ability to promote tissue repair and regeneration in models of ischemia and injury. Understanding the properties and functionalities of recombinant ANGPT1 not only aids in elucidating its biological role but also paves the way for developing novel therapeutic strategies aimed at modulating angiogenesis in various diseases. The growing interest in ANGPT1 reflects its promise as a target for drug development, underscoring the importance of continuing research in this area to fully leverage its beneficial effects in clinical applications.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US