Cat: PA1000-130DB

Recombinant Human AKR1C4 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    AKR1C4

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    AKR1C4;CHDR;Aldo-keto reductase family 1 member C4

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P17516

  • Expression Region

    1-343aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMDPKYQRVELNDGHFMPVLGFGTYAPPEVP RNRAVEVTKLAIEAGFRHIDSAYLYNNEEQVGLAIRSKIADGSVKREDIF YTSKLWCTFFQPQMVQPALESSLKKLQLDYVDLYLLHFPMALKPGETPLP KDENGKVIFDTVDLSATWEVMEKCKDAGLAKSIGVSNFNCRQLEMILNKP GLKYKPVCNQVECHPYLNQSKLLDFCKSKDIVLVAHSALGTQRHKLWVDP NSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIREN IQVFEFQLTSEDMKVLDGLNRNYRYVVMDFLMDHPDYPFSDEY

  • Molecular Weight

    39 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

AKR1C4, or Aldo-Keto Reductase Family 1 Member C4, is a crucial enzyme involved in the metabolism of steroid hormones and xenobiotics, playing a significant role in various physiological processes. This enzyme is encoded by the AKR1C4 gene and is primarily expressed in the liver, kidneys, and reproductive tissues. It catalyzes the reduction of ketones and aldehydes, contributing to the biosynthesis of important steroid hormones like progesterone and testosterone, as well as the detoxification of harmful aldehydes. Research into AKR1C4 has gained traction in recent years due to its implications in various diseases, particularly its association with cancer progression, especially in hormone-dependent tumors. Elevated levels of AKR1C4 have been linked to poor prognosis in breast and prostate cancers, highlighting its potential as a biomarker for disease progression and a target for therapeutic intervention. Moreover, understanding its structure and enzymatic mechanism can aid in the design of selective inhibitors that could mitigate its role in tumor growth. The production of recombinant AKR1C4 proteins for biochemical studies is thus essential for elucidating its function, regulation, and potential as a drug target. Such studies not only contribute to the understanding of steroid metabolism and hormone regulation but also pave the way for novel therapeutic strategies against cancers and other disorders linked to enzyme dysregulation. Consequently, ongoing research into AKR1C4 will enhance our comprehension of its biological significance and its potential application in clinical settings.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US