Analytical Data
-
Gene name
AKR1C4
- Application
-
Alternative Names
AKR1C4;CHDR;Aldo-keto reductase family 1 member C4
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P17516
-
Expression Region
1-343aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMDPKYQRVELNDGHFMPVLGFGTYAPPEVP RNRAVEVTKLAIEAGFRHIDSAYLYNNEEQVGLAIRSKIADGSVKREDIF YTSKLWCTFFQPQMVQPALESSLKKLQLDYVDLYLLHFPMALKPGETPLP KDENGKVIFDTVDLSATWEVMEKCKDAGLAKSIGVSNFNCRQLEMILNKP GLKYKPVCNQVECHPYLNQSKLLDFCKSKDIVLVAHSALGTQRHKLWVDP NSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIREN IQVFEFQLTSEDMKVLDGLNRNYRYVVMDFLMDHPDYPFSDEY
-
Molecular Weight
39 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
AKR1C4, or Aldo-Keto Reductase Family 1 Member C4, is a crucial enzyme involved in the metabolism of steroid hormones and xenobiotics, playing a significant role in various physiological processes. This enzyme is encoded by the AKR1C4 gene and is primarily expressed in the liver, kidneys, and reproductive tissues. It catalyzes the reduction of ketones and aldehydes, contributing to the biosynthesis of important steroid hormones like progesterone and testosterone, as well as the detoxification of harmful aldehydes. Research into AKR1C4 has gained traction in recent years due to its implications in various diseases, particularly its association with cancer progression, especially in hormone-dependent tumors. Elevated levels of AKR1C4 have been linked to poor prognosis in breast and prostate cancers, highlighting its potential as a biomarker for disease progression and a target for therapeutic intervention. Moreover, understanding its structure and enzymatic mechanism can aid in the design of selective inhibitors that could mitigate its role in tumor growth. The production of recombinant AKR1C4 proteins for biochemical studies is thus essential for elucidating its function, regulation, and potential as a drug target. Such studies not only contribute to the understanding of steroid metabolism and hormone regulation but also pave the way for novel therapeutic strategies against cancers and other disorders linked to enzyme dysregulation. Consequently, ongoing research into AKR1C4 will enhance our comprehension of its biological significance and its potential application in clinical settings.











