Analytical Data
-
Gene name
SGK2
- Application
-
Alternative Names
SGK2；Serine/threonine-Protein kinase Sgk2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9HBY8
-
Expression Region
1-427aa
-
AA Sequence
MNSSPAGTPSPQPSRANGNINLGPSANPNAQPTDFDFLKVIGKGNYGKVL LAKRKSDGAFYAVKVLQKKSILKKKEQSHIMAERSVLLKNVRHPFLVGLR YSFQTPEKLYFVLDYVNGGELFFHLQRERRFLEPRARFYAAEVASAIGYL HSLNIIYRDLKPENILLDCQGHVVLTDFGLCKEGVEPEDTTSTFCGTPEY LAPEVLRKEPYDRAVDWWCLGAVLYEMLHGLPPFYSQDVSQMYENILHQP LQIPGGRTVAACDLLQSLLHKDQRQRLGSKADFLEIKNHVFFSPINWDDL YHKRLTPPFNPNVTGPADLKHFDPEFTQEAVSKSIGCTPDTVASSSGASS AFLGFSYAPEDDDILDC
-
Molecular Weight
71 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SGK2 (Serum/glucocorticoid-regulated kinase 2) is a member of the AGC kinase family, which plays a crucial role in various cellular processes, including cell survival, proliferation, and stress response. It is particularly implicated in the regulation of ion transport and metabolic pathways, making it a significant focal point in studies related to cardiovascular diseases, cancer, and diabetes. The interest in SGK2 has surged due to its potential as a therapeutic target and biomarker. Understanding SGK2's molecular mechanisms, interactions, and regulatory pathways requires the generation of recombinant SGK2 proteins for in vitro analysis and functional studies. Such research aims to elucidate the kinase's structure-function relationship and its role in disease progression, which could pave the way for the development of novel therapeutic strategies. Recent advances in protein expression systems and purification techniques have facilitated the production of high-purity SGK2, allowing researchers to investigate its enzymatic activity, phosphorylation targets, and involvement in signaling cascades. Given the complexity of SGK2's regulatory network, ongoing studies are essential to clarify its biological significance and therapeutic potential, particularly in the context of disorders where SGK2 dysregulation is observed. These investigations not only enhance our understanding of SGK2 but also contribute to the broader field of kinase research and its implications in human health.
