Cat: PA1000-126DB

Recombinant Human ALDH5A1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    ALDH5A1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    ALDH5A1;SSADH;Succinate-semialdehyde dehydrogenase. mitochondrial

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P51649

  • Expression Region

    48-535aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMAGRLAGLSAALLRTDSFVGGRWLPAAATF PVQDPASGAALGMVADCGVREARAAVRAAYEAFCRWREVSAKERSSLLRK WYNLMIQNKDDLARIITAESGKPLKEAHGEILYSAFFLEWFSEEARRVYG DIIHTPAKDRRALVLKQPIGVAAVITPWNFPSAMITRKVGAALAAGCTVV VKPAEDTPFSALALAELASQAGIPSGVYNVIPCSRKNAKEVGEAICTDPL VSKISFTGSTTTGKILLHHAANSVKRVSMELGGLAPFIVFDSANVDQAVA GAMASKFRNTGQTCVCSNQFLVQRGIHDAFVKAFAEAMKKNLRVGNGFEE GTTQGPLINEKAVEKVEKQVNDAVSKGATVVTGGKRHQLGKNFFEPTLLC NVTQDMLCTHEETFGPLAPVIKFDTEEEAIAIANAADVGLAGYFYSQDPA QIWRVAEQLEVGMVGVNEGLISSVECPFGGVKQSGLGREGSKYGIDEYLE LKYVCYGGL

  • Molecular Weight

    55 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

ALDH5A1 (aldehyde dehydrogenase 5 family member A1) is an enzyme critically involved in the catabolism of gamma-aminobutyric acid (GABA), playing a vital role in maintaining the balance of neurotransmitters in the brain. Deficiencies in ALDH5A1 are associated with hereditary neurological disorders, such as succinic semialdehyde dehydrogenase deficiency, which can result in developmental delays, seizures, and other significant neurological symptoms. Due to its importance in both metabolic pathways and neurological function, the recombinant production of ALDH5A1 protein has become a focus of research. Utilizing recombinant DNA technology allows for the generation of this enzyme in sufficient quantities for biochemical and structural studies, facilitating a deeper understanding of its function and role in disease. Furthermore, insights gained from this research could lead to the identification of potential therapeutic targets or the development of enzyme replacement therapies for individuals affected by ALDH5A1-related disorders. The expression and purification of recombinant ALDH5A1 provide valuable tools for studying its enzymatic properties, structural features, and interactions with other molecules, thereby contributing to advancements in the treatment and understanding of neurological conditions linked to GABA metabolism. As research continues to unravel the complexities of ALDH5A1, its potential implications in both basic science and clinical applications become increasingly apparent, emphasizing the importance of this enzyme in human health.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US