Cat: PA1000-91DB

Recombinant Human AICDA Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    AICDA

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    AICDA;AID;Single-stranded DNA cytosine deaminase

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9GZX7

  • Expression Region

    1-198aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMDSLLMNRRKFLYQFKNVRWAKGRRETYLC YVVKRRDSATSFSLDFGYLRNKNGCHVELLFLRYISDWDLDPGRCYRVTW FTSWSPCYDCARHVADFLRGNPNLSLRIFTARLYFCEDRKAEPEGLRRLH RAGVQIAIMTFKDYFYCWNTFVENHERTFKAWEGLHENSVRLSRQLRRIL LPLYEVDDLRDAFRTLGL

  • Molecular Weight

    26 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

AICDA (Activation-Induced Cytidine Deaminase) is a crucial enzyme involved in the process of somatic hypermutation and class switch recombination in B cells, playing a vital role in the adaptive immune response. Research into AICDA has gained momentum due to its significance in maintaining the diversity of antibodies and its implications in immunological disorders. Dysregulated AICDA activity has been linked to various pathologies, including lymphomas and other cancers, as well as autoimmune diseases, highlighting the importance of understanding its regulatory mechanisms. The study of AICDA is further enhanced by the need to develop novel therapeutic interventions targeting B cell malignancies, where AICDA's aberrant function contributes to oncogenesis. Recent advances in recombinant protein technology have made it feasible to produce AICDA in substantial quantities, enabling detailed investigations into its structure-function relationships and enzymatic activity. By elucidating the biochemical and molecular mechanisms underpinning AICDA's actions, researchers aim to uncover potential targets for drug development and to design innovative treatments that could modulate immune responses or counteract the effects of AICDA in pathological contexts. Overall, the investigation of AICDA's role in immune regulation and disease susceptibility underscores its potential as a biomolecular target for therapeutic strategies in oncology and immunology.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US