Analytical Data
-
Gene name
AICDA
- Application
-
Alternative Names
AICDA;AID;Single-stranded DNA cytosine deaminase
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9GZX7
-
Expression Region
1-198aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMDSLLMNRRKFLYQFKNVRWAKGRRETYLC YVVKRRDSATSFSLDFGYLRNKNGCHVELLFLRYISDWDLDPGRCYRVTW FTSWSPCYDCARHVADFLRGNPNLSLRIFTARLYFCEDRKAEPEGLRRLH RAGVQIAIMTFKDYFYCWNTFVENHERTFKAWEGLHENSVRLSRQLRRIL LPLYEVDDLRDAFRTLGL
-
Molecular Weight
26 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
AICDA (Activation-Induced Cytidine Deaminase) is a crucial enzyme involved in the process of somatic hypermutation and class switch recombination in B cells, playing a vital role in the adaptive immune response. Research into AICDA has gained momentum due to its significance in maintaining the diversity of antibodies and its implications in immunological disorders. Dysregulated AICDA activity has been linked to various pathologies, including lymphomas and other cancers, as well as autoimmune diseases, highlighting the importance of understanding its regulatory mechanisms. The study of AICDA is further enhanced by the need to develop novel therapeutic interventions targeting B cell malignancies, where AICDA's aberrant function contributes to oncogenesis. Recent advances in recombinant protein technology have made it feasible to produce AICDA in substantial quantities, enabling detailed investigations into its structure-function relationships and enzymatic activity. By elucidating the biochemical and molecular mechanisms underpinning AICDA's actions, researchers aim to uncover potential targets for drug development and to design innovative treatments that could modulate immune responses or counteract the effects of AICDA in pathological contexts. Overall, the investigation of AICDA's role in immune regulation and disease susceptibility underscores its potential as a biomolecular target for therapeutic strategies in oncology and immunology.











