Cat: PA1000-43DB

Recombinant Human ACP6 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    ACP6

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    ACP6;ACPL1;LPAP;Lysophosphatidic acid phosphatase type 6

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9NPH0

  • Expression Region

    33 -428aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGSELQEADGQCPVDRSLLKLKMVQVVFRH GARSPLKPLPLEEQVEWNPQLLEVPPQTQFDYTVTNLAGGPKPYSPYDSQ YHETTLKGGMFAGQLTKVGMQQMFALGERLRKNYVEDIPFLSPTFNPQEV FIRSTNIFRNLESTRCLLAGLFQCQKEGPIIIHTDEADSEVLYPNYQSCW SLRQRTRGRRQTASLQPGISEDLKKVKDRMGIDSSDKVDFFILLDNVAAE QAHNLPSCPMLKRFARMIEQRAVDTSLYILPKEDRESLQMAVGPFLHILE SNLLKAMDSATAPDKIRKLYLYAAHDVTFIPLLMTLGIFDHKWPPFAVDL TMELYQHLESKEWFVQLYYHGKEQVPRGCPDGLCPLDMFLNAMSVYTLSP EKYHALCSQTQVMEVGNEE

  • Molecular Weight

    48 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

The research on ACP6 recombinant protein has gained significant traction due to its potential role in various biological processes, particularly in the regulation of RNA metabolism. ACP6, or Acidic Cysteine Proteinase 6, is a member of the phosphohydrolase family and is primarily involved in dephosphorylating RNA molecules, which is essential for RNA maturation, stability, and degradation. As the understanding of RNA regulation in cellular processes deepens, the need for detailed studies on proteins like ACP6 has become increasingly critical. The recombinant production of ACP6 allows for detailed biochemical characterization and the exploration of its functional mechanisms in a controlled environment. Furthermore, ACP6 has been implicated in diverse physiological conditions, including viral infections and gene expression regulation, prompting investigations into its therapeutic potential. By harnessing recombinant DNA technology to produce this protein, researchers aim to elucidate its structure-function relationship and its implications in health and disease, paving the way for novel biomolecular applications and therapeutic strategies. This research not only contributes to the fundamental understanding of RNA biology but also offers insights into possible interventions for diseases linked to RNA dysregulation.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US