Analytical Data
-
Gene name
ACP2
- Application
-
Alternative Names
ACP2；Lysosomal acid phosphatase
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P11117
-
Expression Region
31-380aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSRSLRFVTLLYRHGDRSPVKTYPKDPYQ EEEWPQGFGQLTKEGMLQHWELGQALRQRYHGFLNTSYHRQEVYVRSTDF DRTLMSAEANLAGLFPPNGMQRFNPNISWQPIPVHTVPITEDRLLKFPLG PCPRYEQLQNETRQTPEYQNESSRNAQFLDMVANETGLTDLTLETVWNVY DTLFCEQTHGLRLPPWASPQTMQRLSRLKDFSFRFLFGIYQQAEKARLQG GVLLAQIRKNLTLMATTSQLPKLLVYSAHDTTLVALQMALDVYNGEQAPY ASCHIFELYQEDSGNFSVEMYFRNESDKAPWPLSLPGCPHRCPLQDFLRL TEPVVPKDWQQECQLASGPADTE
-
Molecular Weight
43 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ACP2 (Acid Ceramidase, also known as ASAH2) is an important enzyme involved in sphingolipid metabolism, playing a critical role in the hydrolysis of ceramides into sphingosine and fatty acids. This process is vital for cellular functions, including cell signaling, proliferation, and apoptosis. Deficiencies or mutations in the ACP2 gene have been linked to various pathological conditions, such as Farber's disease, a rare lysosomal storage disorder characterized by ceramide accumulation, leading to severe neurological and physical impairments. The study of recombinant ACP2 protein is significant for understanding its enzymatic activity, substrate specificity, and potential therapeutic applications. By producing and characterizing this protein, researchers aim to elucidate the enzyme's structure-function relationships and investigate its role in disease mechanisms. Additionally, recombinant ACP2 can serve as a valuable tool for drug development, as inhibiting or enhancing its activity may provide novel strategies for treating sphingolipid-related disorders. Furthermore, the production of ACP2 in a controlled laboratory setting facilitates in-depth studies of its interactions with other cellular components, paving the way for advancements in targeted therapies. Overall, the research on recombinant ACP2 is crucial for both basic science and clinical applications, contributing to the broader understanding of lipid metabolism and its implications for human health.
