Cat: PA1000-8903

Recombinant Human IRS3 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    IRS3

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    IRS3;

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q14653

  • Expression Region

    2-427aa

  • AA Sequence

    MASMTGGQQMGRGHHHHHHENLYFQGEFGTPKPRILPWLVSQLDLGQLEG VAWVNKSRTRFRIPWKHGLRQDAQQEDFGIFQAWAEATGAYVPGRDKPDL PTWKRNFRSALNRKEGLRLAEDRSKDPHDPHKIYEFVNSGVGDFSQPDTS PDTNGGGSTSDTQEDILDELLGNMVLAPLPDPGPPSLAVAPEPCPQPLRS PSLDNPTPFPNLGPSENPLKRLLVPGEEWEFEVTAFYRGRQVFQQTISCP EGLRLVGSEVGDRTLPGWPVTLPDPGMSLTDRGVMSYVRHVLSCLGGGLA LWRAGQWLWAQRLGHCHTYWAVSEELLPNSGHGPDGEVPKDKEGGVFDLG PFIVDLITFTEGSGRSPRYALWFCVGESWPQDQPWTKRLVMVKVVPTCLR ALVEMARVGGASSLENTVDLHISNSHPLSLTSDQYKAYLQDLVEGMDFQG PGES

  • Molecular Weight

    50 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

IRS3 (insulin receptor substrate 3) is a key adapter protein involved in insulin signaling and metabolic regulation. Its role in mediating the effects of insulin on glucose uptake, lipid metabolism, and cell growth has garnered significant interest in the field of diabetes and obesity research. IRS3 exists as a member of the IRS family, which also includes IRS1 and IRS2, and its expression and functional dynamics are closely linked to various metabolic disorders. Recent studies have indicated that IRS3 may influence insulin sensitivity and resistance, making it a potential target for therapeutic interventions aimed at treating type 2 diabetes and related conditions. Furthermore, the characterization of IRS3 as a recombinant protein has facilitated investigations into its structure-function relationships, signaling pathways, and interactions with other molecules involved in metabolic networks. Understanding IRS3's mechanisms may provide insights for developing novel strategies to enhance insulin action and improve metabolic homeostasis, paving the way for innovative treatments directly targeting the underlying causes of insulin resistance. As a result, IRS3 recombinant protein research is critical for elucidating the complexities of insulin signaling and metabolic health, contributing to both basic science and clinical applications in endocrinology and metabolic disease management.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US