Analytical Data
-
Gene name
INSL5
- Application
-
Alternative Names
INSL5；Insulin-like peptide INSL5
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8TDU9
-
Expression Region
1-374aa
-
AA Sequence
MPTLNTSASPPTFFWANASGGSVLSADDAPMPVKFLALRLMVALAYGLVGAIGLLGNLAVLWVLSNCARRAPGPPSDTFVFNLALADLGLALTLPFWAAESALDFHWPFGGALCKMVLTATVLNVYASIFLITALSVARYWVVAMAAGPGTHLSLFWARIATLAVWAAAALVTVPTAVFGVEGEVCGVRLCLLRFPSRYWLGAYQLQRVVLAFMVPLGVITTSYLLLLAFLQRRQRRRQDSRVVARSVRILVASFFLCWFPNHVVTLWGVLVKFDLVPWNSTFYTIQTYVFPVTTCLAHSNSCLNPVLYCLLRREPRQALAGTFRDLRLRLWPQGGGWVQQVALKQVGRRWVASNPRESRPSTLLTNLDRGTPG
-
Molecular Weight
41.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
INSL5 (Insulinoma-associated protein 5) is a member of the insulin superfamily, primarily expressed in the intestinal enteroendocrine L-cells. It has garnered interest due to its potential role in regulating human metabolic processes, particularly in relation to insulin secretion and glucose homeostasis. Research indicates that INSL5 may be involved in the modulation of appetite and energy expenditure, suggesting its relevance in obesity and diabetes research. Unlike other insulin-like peptides, INSL5's specific physiological functions and mechanisms of action remain largely unexplored. The production of recombinant INSL5 protein has become a focal point for scientists aiming to elucidate its biological roles. This recombinant protein can be utilized in both in vitro and in vivo studies to investigate its receptor interactions and downstream signaling pathways. Furthermore, understanding the structure-function relationships of INSL5 may reveal novel therapeutic targets for metabolic disorders. The ongoing exploration of this peptide underscores its potential implications in metabolic health and disease, paving the way for future interventions in metabolic syndrome and related conditions. As researchers continue to unravel the complexities of INSL5, further studies will likely provide greater insights into its role as a biomarker or therapeutic target in managing metabolic diseases.
