Analytical Data
-
Gene name
KIR3DS1/CD158e2
-
简介
KIR3DS1/CD158e2, located on NK cells, serves as a receptor for MHC class I molecules. Its crucial role includes triggering NK cell degranulation and inducing the production of anti-viral cytokines upon interaction with the peptide-free HLA-F open conformer. This direct engagement highlights KIR3DS1/CD158e2 as a key modulator of NK cell responses, particularly in anti-viral immune reactions. KIR3DS1/CD158e2 Protein, Human (CHO, His) is the recombinant human-derived KIR3DS1/CD158e2 protein, expressed by CHO , with tag free.
- Application
-
Biological Activity
Immobilized Human KIR3DS1, at 2 μg/mL (100μL/well) can bind Anti-KIR3DS1 antibody. The ED50 for this effect is 0.9047 μg/mL. Immobilized Human KIR3DS1, at 2 μg/mL (100 μL/well) can bind Anti-KIR3DS1 antibody. The ED50 for this effect is 0.9047 μg/mL.
-
Alternative Names
Killer cell immunoglobulin-like receptor 3DS1; KIR3DS1; Natural killer-associated transcript 10; NKAT-10; NKAT10; Killer Cell Immunoglobulin-like Receptor, Three Domains, Long Cytoplasmic Tail, 1
-
Species
Human
-
Source
CHO
-
Tag
C-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q14943-1
-
Expression Region
H22-H340
-
AA Sequence
HMGGQDKPFLSAWPSAVVPRGGHVTLRCHYRHRFNNFMLYKEDRIHIPIFHGRIFQESFNMSPVTTAHAGNYTCRGSHPHSPTGWSAPSNPVVIMVTGNHRKPSLLAHPGPLVKSGERVILQCWSDIMFEHFFLHKEGISKDPSRLVGQIHDGVSKANFSIGPMMLALAGTYRCYGSVTHTPYQLSAPSDPLDIVVTGPYEKPSLSAQPGPKVQAGESVTLSCSSRSSYDMYHLSREGGAHERRLPAVRKVNRTFQADFPLGPATHGGTYRCFGSFRHSPYEWSDPSDPLLVSVTGNPSSSWPSPTEPSSKSGNPRHLH
-
Protein Length
Extracellular Domain
-
Molecular Weight
40-57 kDa.
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The KIR3DS1/CD158e2 protein, a member of the Killer Cell Immunoglobulin-like Receptor (KIR) family, plays a critical role in the regulation of immune responses, particularly in natural killer (NK) cells. KIRs are essential for distinguishing between healthy and infected or malignant cells, as they bind to specific ligands on target cells. KIR3DS1 is characterized as an activating receptor that responds to specific class I Major Histocompatibility Complex (MHC) molecules, influencing NK cell activity. Research has indicated that KIR3DS1 can enhance the cytotoxic response of NK cells against certain pathogens and tumors, making it a focal point for understanding immune evasion mechanisms employed by tumors and viruses. Its expression is linked to various clinical outcomes in diseases, particularly HIV infection, where KIR3DS1-positive individuals show different susceptibility and progression rates. The study of KIR3DS1/CD158e2 recombinant proteins offers insights into its molecular interactions and potential therapeutic applications, such as in cancer immunotherapy or vaccine development. Furthermore, understanding this receptor's structure and function helps elucidate the complex network of immune regulation and has implications for enhancing NK cell-mediated immunity in various clinical settings.
