Analytical Data
-
Gene name
L-selectin/CD62L
-
简介
The L-selectin/CD62L protein is a calcium-dependent lectin that promotes cell adhesion by binding to glycoproteins on neighboring cells. L-selectin/CD62L Protein, Human (HEK293, His) is the recombinant human-derived L-selectin/CD62L protein, expressed by HEK293 , with C-His labeled tag.
- Application
-
Biological Activity
Measured by the ability of the immobilized protein to support the adhesion of THP-1 human prostate cancer cells. The ED50 for this effect is 1.0-3.0 μg/mL. Measured by the ability of the immobilized protein to support the adhesion of THP-1 human prostate cancer cells. The ED50 for this effect is 2.231 μg/mL, corresponding to a specific activity is 448.230 units/mg.
-
Alternative Names
L-selectin; Sell; CD62 antigen-like family member L; LECAM1; CD62L; LAM-1
-
Species
Human
-
Source
HEK293
-
Tag
C-6*His
-
Purity
Greater than 95% as determined by SDS-PAGE.
-
Uniprot
P14151
-
Expression Region
W39-N332
-
AA Sequence
WTYHYSEKPMNWQRARRFCRDNYTDLVAIQNKAEIEYLEKTLPFSRSYYWIGIRKIGGIWTWVGTNKSLTEEAENWGDGEPNNKKNKEDCVEIYIKRNKDAGKWNDDACHKLKAALCYTASCQPWSCSGHGECVEIINNYTCNCDVGYYGPQCQFVIQCEPLEAPELGTMDCTHPLGNFSFSSQCAFSCSEGTNLTGIEETTCGPFGNWSSPEPTCQVIQCEPLSAPDLGIMNCSHPLASFSFTSACTFICSEGTELIGKKKTICESSGIWSNPSPICQKLDKSFSMIKEGDYN
-
Protein Length
Extracellular Domain
-
Molecular Weight
50-75 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
L-selectin, also known as CD62L, is a cell adhesion molecule predominantly expressed on leukocytes. It plays a crucial role in mediating the initial interactions between circulating white blood cells and the endothelial cells of blood vessels, facilitating the process of leukocyte rolling and subsequent migration to sites of inflammation or injury. Given its vital function in immune responses and inflammation, L-selectin has emerged as an important target for therapeutic interventions in various diseases, including autoimmune disorders, chronic inflammation, and cancer. Research on L-selectin/CD62L recombinant proteins has gained traction as these proteins can be used as tools to investigate the mechanistic pathways of leukocyte trafficking, assess immune responses, and develop novel treatment strategies. The recombinant variants of L-selectin can also serve in the creation of targeted drug delivery systems and enhance the understanding of cellular interactions in the immune system. Moreover, by engineering L-selectin for improved stability and specificity, researchers aim to unlock its potential in clinical applications, making it a significant area of study in immunology and biomedicine. This ongoing research holds promise for advancing both basic science and potential therapeutic avenues, highlighting the importance of L-selectin in maintaining immune homeostasis and combating diseases linked to immune dysfunction.











