Cat: IPD-X26080

Recombinant Human RKIP/PEBP1 Protein

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    RKIP/PEBP1

  • 简介

    The RKIP/PEBP1 protein has diverse binding capabilities and can interact with ATP, opioids, and phosphatidylethanolamine. It acts as a serine protease inhibitor, effectively inhibiting thrombin, neuroproteases, and chymotrypsin. RKIP/PEBP1 Protein, Human is the recombinant human-derived RKIP/PEBP1 protein, expressed by E. coli , with tag free.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Phosphatidylethanolamine-binding protein 1; HCNPpp; Neuropolypeptide h3; HCNP; PBP; PEBP

  • Species

    Human

  • Source

    E. coli

  • Tag

    Tag Free

  • Purity

    Greater than 95% as determined by SDS-PAGE.

  • Uniprot

    P30086

  • Expression Region

    M1-K187

  • AA Sequence

    MPVDLSKWSGPLSLQEVDEQPQHPLHVTYAGAAVDELGKVLTPTQVKNRPTSISWDGLDSGKLYTLVLTDPDAPSRKDPKYREWHHFLVVNMKGNDISSGTVLSDYVGSGPPKGTGLHRYVWLVYEQDRPLKCDEPILSNRSGDHRGKFKVASFRKKYELRAPVAGTCYQAEWDDYVPKLYEQLSGK

  • Protein Length

    Full Length

  • Molecular Weight

    21.1 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

RKIP (Raf Kinase Inhibitory Protein) or PEBP1 (Phosphatidylethanolamine Binding Protein 1) is a multifunctional protein that plays a crucial role in various cellular processes, including cell signaling, proliferation, and apoptosis. It acts as a negative regulator of the Raf-MEK-ERK signaling pathway, which is pivotal in cancer progression. The dysregulation of RKIP/PEBP1 has been linked to various malignancies, making it a potential target for cancer therapy. Additionally, RKIP/PEBP1 is involved in regulating other pathways, such as the NF-κB signaling pathway, and influences processes like inflammation and immune responses. Given its involvement in tumor suppression and cellular homeostasis, research has focused on understanding the mechanisms of RKIP/PEBP1 function and its interactions with different proteins. Moreover, the development of recombinant RKIP/PEBP1 proteins has opened new avenues for studying its structural properties, functional roles, and therapeutic potentials, especially in targeted cancer treatments. Overall, the investigation of RKIP/PEBP1 aims to elucidate its biological significance and therapeutic implications in cancer and other diseases.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US