Analytical Data
-
Gene name
RGMB
-
简介
RGMB, a member of the RGM family, shapes the developing nervous system as a BMP coreceptor. It enhances BMP signaling and modulates neuronal adhesion. RGMB forms homooligomers and interacts with DRGX, BMP2, BMP4, ACVR1, BMPR1A, BMPR1B, and ACVR2B. It also forms a functional complex with NEO1/neogenin, activating downstream signaling via RhoA. RGMB Protein, Mouse (HEK293, His) is the recombinant mouse-derived RGMB protein, expressed by HEK293 , with C-10*His labeled tag.
- Application
-
Alternative Names
Repulsive guidance molecule B; RGM-B
-
Species
Mouse
-
Source
HEK293
-
Tag
C-10*His
-
Purity
Greater than 95% as determined by SDS-PAGE.
-
Uniprot
Q7TQ33
-
Expression Region
G49-C415
-
AA Sequence
GDCQQPTQCRIQKCTTDFVALTAHLNSAADGFDSEFCKALRAYAGCTQRTSKACRGNLVYHSAVLGISDLMSQRNCSKDGPTSSTNPEVTHDPCNYHSHGGVREHGGGDQRPPNYLFCGLFGDPHLRTFKDHFQTCKVEGAWPLIDNNYLSVQVTNVPVVPGSSATATNKVTIIFKAQHECTDQKVYQAVTDDLPAAFVDGTTSGGDGDVKSLHIVEKESGRYVEMHARYIGTTVFVRQLGRYLTLAIRMPEDLAMSYEESQDLQLCVNGCPMSECIDDGQGQVSAILGHSLPHTTSVQAWPGYTLETASTQCHEKMPVKDIYFQSCVFDLLTTGDANFTAAAHSALEDVEALHPRKERWHIFPSSC
-
Protein Length
Full Length of Rgmb
-
Molecular Weight
40.2 kDa.
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
RGMB (repulsive guidance molecule B) is a member of the RGMs family, which plays a critical role in neuronal development and axon guidance. Originally identified in the central nervous system, RGMB is known to interact with the bone morphogenetic protein (BMP) signaling pathway, influencing various biological processes such as cell differentiation, migration, and survival. Research has highlighted its potential implications in several neurological disorders and cancers, making it a significant target for therapeutic interventions. The study of recombinant RGMB proteins allows researchers to explore their structural properties, interactions, and functional roles in cellular contexts. By producing RGMB in a recombinant form, scientists can conduct detailed investigations into its mechanisms of action, assess its efficacy as a therapeutic agent, and evaluate its potential in regenerative medicine. The ongoing research into RGMB is crucial for understanding its comprehensive role in health and disease, offering promising avenues for developing novel treatments that leverage its biological functions.
