Cat: IPD-X30037

Recombinant Human Kallikrein-7 Protein (HEK293),His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    Kallikrein-7

  • 简介

    Kallikrein-7 is a serine protease with chymotrypsin-like activity that plays a role in intercellular proteolysis, leading to epidermal exfoliation. It is involved in cancer invasion and metastasis, and elevated expression is associated with poor prognosis and cancer progression. Kallikrein-7 Protein, Human (HEK293, His) is the recombinant human-derived Kallikrein-7 protein, expressed by HEK293 , with C-10*His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Kallikrein-7; Serine protease 6; hSCCE; KLK7; PRSS6; SCCE

  • Species

    Human

  • Source

    HEK293

  • Tag

    C-10*His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    NP_005037.1

  • Expression Region

    E23-R253

  • AA Sequence

    EEAQGDKIIDGAPCARGSHPWQVALLSGNQLHCGGVLVNERWVLTAAHCKMNEYTVHLGSDTLGDRRAQRIKASKSFRHPGYSTQTHVNDLMLVKLNSQARLSSMVKKVRLPSRCEPPGTTCTVSGWGTTTSPDVTFPSDLMCVDVKLISPQDCTKVYKDLLENSMLCAGIPDSKKNACNGDSGGPLVCRGTLQGLVSWGTFPCGQPNDPGVYTQVCKFTKWINDTMKKHR

  • Protein Length

    Full Length of Mature Protein

  • Molecular Weight

    30-33 kDa.

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Kallikrein-7 (KLK7) is a member of the kallikrein family of serine proteases, which play a crucial role in various physiological processes, including skin homeostasis, inflammation, and tissue remodeling. KLK7 is predominantly expressed in the skin and is implicated in the degradation of keratin, a key structural protein in the epidermis. Research has demonstrated that altered expression of KLK7 is associated with several dermatological conditions, including psoriasis, dermatitis, and skin cancer. The interest in KLK7 as a therapeutic target has grown, particularly due to its potential role in mediating inflammatory responses and promoting keratinocyte proliferation. Furthermore, KLK7 has been suggested as a biomarker for certain diseases, making it a focal point in diagnostic research. To investigate its functions and develop potential therapeutic applications, researchers have focused on producing recombinant KLK7 protein. This involves using modern biotechnological methods to express and purify KLK7 in vitro, allowing for in-depth studies of its enzymatic activity, regulation, and involvement in pathophysiological processes. Understanding KLK7's mechanisms could lead to innovative treatments for skin disorders and provide insights into other diseases linked to its dysregulation, highlighting its importance in both basic research and clinical applications.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US