Analytical Data
-
Gene name
SRPX2
-
简介
The SRPX2 protein is a ligand for the urokinase plasminogen activator surface receptor and promotes angiogenesis by inducing endothelial cell migration and vascular network formation. It also exerts critical effects on cell migration and adhesion, increases FAK phosphorylation and enhances HGF mitogenic activity. SRPX2 Protein, Mouse (Myc, His-SUMO) is the recombinant mouse-derived SRPX2 protein, expressed by E. coli , with N-His, C-Myc, N-SUMO labeled tag.
- Application
-
Alternative Names
Srpx2; Sushi repeat-containing protein SRPX2
-
Species
Mouse
-
Source
E. coli
-
Tag
N-His;C-Myc;N-SUMO
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8R054
-
Expression Region
W26-E468
-
AA Sequence
WYAGSGYSPDESYNEVYAEEVPAARARALDYRVPRWCYTLNIQDGEATCYSPRGGNYHSSLGTRCELSCDRGFRLIGRKSVQCLPSRRWSGTAYCRQIRCHTLPFITSGTYTCTNGMLLDSRCDYSCSSGYHLEGDRSRICMEDGRWSGGEPVCVDIDPPKIRCPHSREKMAEPEKLTARVYWDPPLVKDSADGTITRVTLRGPEPGSHFPEGEHVIRYTAYDRAYNRASCKFIVKVQVRRCPILKPPQHGYLTCSSAGDNYGAICEYHCDGGYERQGTPSRVCQSSRQWSGTPPVCTPMKINVNVNSAAGLLDQFYEKQRLLIVSAPDPSNRYYKMQISMLQQSTCGLDLRHVTIIELVGQPPQEVGRIREQQLSAGIIEELRQFQRLTRSYFNMVLIDKQGIDRERYMEPVTPEEIFTFIDDYLLSNEELARRVEQRDLCE
-
Protein Length
Full Length of Mature Protein
-
Molecular Weight
70.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SRPX2 (Sushi-repeat-containing protein X-linked 2) is a member of the sushi protein family, characterized by the presence of sushi repeats, which are involved in protein-protein interactions. Research into SRPX2 has gained prominence due to its potential role in various biological processes, including neurodevelopment, synaptic function, and the regulation of cell adhesion. Alterations in SRPX2 expression have been implicated in several neurological disorders, such as autism spectrum disorders and schizophrenia, making it a significant target for understanding the molecular mechanisms underlying these conditions. Additionally, SRPX2 has been connected to cancer biology, where its dysregulation may affect tumor progression and metastasis. Given its multifaceted roles in both neurological and oncological contexts, studying SRPX2 through recombinant protein techniques allows for a deeper understanding of its structure and function, facilitating the development of therapeutic interventions. Overall, SRPX2 presents a compelling model for investigating the intersections of neuronal development and cancer, highlighting the necessity for further exploration of its potential as a biomarker or therapeutic target in various disorders.











