Analytical Data
-
Gene name
ETFR-2/TEAD-4
-
简介
ETFR-2/TEAD-4 protein is a key transcription factor that tightly regulates the Hippo signaling pathway and is an integral component of organ size control and tumor suppression. In this pathway, it mediates a kinase cascade involving MST1/MST2, SAV1, LATS1/2, and MOB1, leading to the inactivation of YAP1 and WWTR1/TAZ. ETFR-2/TEAD-4 Protein, Mouse is the recombinant mouse-derived ETFR-2/TEAD-4 protein, expressed by E. coli , with tag free.
- Application
-
Alternative Names
ETF-related factor 2; ETFR-2; TEA domain family member 4; TEAD-4; TEF-1-related factor 1; TEF-1-related factor FR-19; RTEF-1
-
Species
Mouse
-
Source
E. coli
-
Tag
Tag Free
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q62296-1
-
Expression Region
R210-E427
-
AA Sequence
RSIASSKLWMLEFSAFLERQQDPDTYNKHLFVHISQSSPSYSDPYLETVDIRQIYDKFPEKKGGLKELFERGPSNAFFLVKFWADLNTNIDDEGSAFYGVSSQYESPENMIITCSTKVCSFGKQVVEKVETEYARYENGHYLYRIHRSPLCEYMINFIHKLKHLPEKYMMNSVLENFTILQVVTNRDTQETLLCIAYVFEVSASEHGAQHHIYRLVKE
-
Protein Length
Partial
-
Molecular Weight
25.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ETFR-2 (Endothelial Cell-Specific Tie-Related Protein 2) and TEAD-4 (Transcriptional Enhanced Associate Domain 4) are critical proteins implicated in vascular biology and cellular signaling pathways. Research into ETFR-2 has highlighted its role in endothelial cell function, particularly in angiogenesis and vascular stability. Dysregulation of ETFR-2 is linked to various cardiovascular diseases and tumor vascularization, making it a target for therapeutic interventions. TEAD-4, on the other hand, is a key transcription factor that interacts with the Hippo signaling pathway, which is essential for regulating organ size, cell proliferation, and differentiation. This interaction influences developmental processes and tissue homeostasis, with implications in cancer biology when dysregulated. The study of ETFR-2 and TEAD-4 recombinant proteins allows researchers to explore their individual and combinatorial effects on gene expression and cellular behavior in various disease models. Understanding how these proteins function at a molecular level can lead to new insights into vascular diseases and provide potential therapeutic strategies, particularly in targeting aberrant angiogenesis in tumors. Overall, the investigation of ETFR-2 and TEAD-4 not only sheds light on important biological processes but also opens doors for innovative treatments in regenerative medicine and oncology.
