Analytical Data
-
Gene name
TRIM21
-
简介
TRIM21 is an E3 ubiquitin protein ligase that forms complexes with E2 enzymes including UBE2D1 and UBE2E2.It cooperates with UBE2D2 to ubiquitinate USP4, IKBKB and itself, and binds to SCF E3 ligase to mediate ubiquitination of CDKN1B.TRIM21 Protein, Mouse (His-SUMO) is the recombinant mouse-derived TRIM21 protein, expressed by E.coli , with N-His, N-SUMO labeled tag.
- Application
-
Species
Mouse
-
Source
E. coli
-
Tag
N-His;N-SUMO
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q62191
-
Expression Region
M1-M470
-
AA Sequence
MSPSTTSKMSLEKMWEEVTCSICLDPMVEPMSIECGHCFCKECIFEVGKNGGSSCPECRQQFLLRNLRPNRHIANMVENLKQIAQNTKKSTQETHCMKHGEKLHLFCEEDGQALCWVCAQSGKHRDHTRVPIEEAAKVYQEKIHVVLEKLRKGKELAEKMEMDLTMQRTDWKRNIDTQKSRIHAEFALQNSLLAQEEQRQLQRLEKDQREYLRLLGKKEAELAEKNQALQELISELERRIRGSELELLQEVRIILERSGSWNLDTLDIDAPDLTSTCPVPGRKKMLRTCWVHITLDRNTANSWLIISKDRRQVRMGDTHQNVSDNKERFSNYPMVLGAQRFSSGKMYWEVDVTQKEAWDLGVCRDSVQRKGQFSLSPENGFWTIWLWQDSYEAGTSPQTTLHIQVPPCQIGIFVDYEAGVVSFYNITDHGSLIYTFSECVFAGPLRPFFNVGFNYSGGNAAPLKLCPLKM
-
Protein Length
Full Length
-
Molecular Weight
70.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TRIM21, a member of the tripartite motif (TRIM) protein family, has drawn significant attention in recent years due to its crucial role in immune response and potential therapeutic applications. This E3 ubiquitin ligase is predominantly expressed in immune cells and is known for its ability to recognize and ubiquitinate immune complexes, thereby leading to their degradation through the proteasome pathway. TRIM21 also functions as an intracellular antibody receptor, capturing viral particles in the cytoplasm and triggering an innate immune response. Its role in modulating inflammation and autoimmunity has made it a target of interest for understanding various diseases, including autoimmune conditions and infections. Additionally, TRIM21's unique properties have spurred research into its use as a platform for developing innovative diagnostic and therapeutic strategies, particularly in vaccine development and targeted drug delivery. This research is further propelled by the increasing need for effective treatments against viral infections and autoimmune diseases, positioning TRIM21 as a potential key player in future immunological research and therapeutic interventions.











