Recombinant Human TWSG1 Protein (HEK293)，His

TWSG1

The TWSG1 protein plays a dual role in BMP signaling, acting as both an antagonist and an agonist. It forms a ternary complex with CHRD and BMP, blocking BMP receptor binding, thereby antagonizing BMP signaling. TWSG1 Protein, Human (HEK293, His) is the recombinant human-derived TWSG1 protein, expressed by HEK293 , with C-6*His labeled tag.

SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

Twisted Gastrulation Protein Homolog 1; TWSG1; TSG

Human

HEK293

C-6*His

Greater than 90% as determined by SDS-PAGE.

Q9GZX9-1

C26-F223

CNKALCASDVSKCLIQELCQCRPGEGNCSCCKECMLCLGALWDECCDCVGMCNPRNYSDTPPTSKSTVEELHEPIPSLFRALTEGDTQLNWNIVSFPVAEELSHHENLVSFLETVNQPHHQNVSVPSNNVHAPYSSDKEHMCTVVYFDDCMSIHQCKISCESMGASKYRWFHNACCECIGPECIDYGSKTVKCMNCMF

Full Length of Isoform-1 Mature Protein

35.0 kDa

< 1.0 EU per μg protein as determined by the LAL method.

Freeze-dried powder

PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.