Analytical Data
-
Gene name
PVR/CD155
- Application
-
Alternative Names
rMuCD155, His; Poliovirus receptor; CD155 antigen; Nectin-like protein 5; Nectin-2; Tage4 receptor; PVR; CD155
-
Species
Mouse
-
Source
HEK293
-
Tag
C-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8K094
-
Expression Region
D29-L348
-
AA Sequence
DIRVLVPYNSTGVLGGSTTLHCSLTSNENVTITQITWMKKDSGGSHALVAVFHPKKGPNIKEPERVKFLAAQQDLRNASLAISNLSVEDEGIYECQIATFPRGSRSTNAWLKVQARPKNTAEALEPSPTLILQDVAKCISANGHPPGRISWPSNVNGSHREMKEPGSQPGTTTVTSYLSMVPSRQADGKNITCTVEHESLQELDQLLVTLSQPYPPENVSISGYDGNWYVGLTNLTLTCEAHSKPAPDMAGYNWSTNTGDFPNSVKRQGNMLLISTVEDGLNNTVIVCEVTNALGSGQGQVHIIVKEKPENMQQNTRLHLHHHHHH
-
Protein Length
Partial
-
Molecular Weight
55-65 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PVR/CD155, a key immunoregulatory protein, is part of the poliovirus receptor family and plays a crucial role in immune modulation and cell signaling. It is expressed on various cells, including immune cells and tumor cells, where it interacts with its receptor, such as DNAM-1, leading to the activation or inhibition of T-cell responses. Research into PVR/CD155 has gained prominence due to its dual function in promoting immune evasion in tumors while also contributing to the immune response against pathogens. In the context of cancer immunotherapy, elevated levels of PVR/CD155 have been associated with poor patient outcomes, making it a potential biomarker and therapeutic target. Moreover, studies exploring recombinant PVR/CD155 proteins aim to elucidate its structure-function relationship and therapeutic potential, including the development of monoclonal antibodies that can enhance anti-tumor immunity. Understanding the molecular mechanisms of PVR/CD155 could pave the way for novel strategies to harness the immune system against cancer and improve therapeutic efficacy in combination with other immunotherapies. Thus, the research surrounding PVR/CD155 is vital for the advancement of cancer immunology and the development of effective treatments.











