Cat: IPD-X18420

Recombinant Human PVR/CD155 Protein(HEK293), hFc

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    PVR/CD155

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Biological Activity

    1. 5 µg/mL (100 µL/well) of immoblized recombinant human PVR/CD155-Fc can bind human Biotin-TIGIT-Fc with a linear range of 6.1-48.8 ng/mL. 2. Measured by its binding ability in a functional ELISA. Immobilized human CD226, at 2 μg/mL (100 μL/well) can bind Biotinylated human CD155 protein. The ED50 for this effect is 37.33 ng/mL, corresponding to a specific activity is 2.679×104 Unit/mg. Measured by its binding ability in a functional ELISA. Immobilized human CD226, at 2 μg/mL (100 μL/well) can bind Biotinylated human CD155 protein. The ED50 for this effect is 37.33 ng/mL, corresponding to a specific activity is 2.679×104 Unit/mg.

  • Alternative Names

    rHuPVR/CD155, Fc Chimera; Poliovirus receptor; NECL-5; PVS

  • Species

    Human

  • Source

    HEK293

  • Tag

    C-hFc

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P15151-1

  • Expression Region

    W21-N343

  • AA Sequence

    WPPPGTGDVVVQAPTQVPGFLGDSVTLPCYLQVPNMEVTHVSQLTWARHGESGSMAVFHQTQGPSYSESKRLEFVAARLGAELRNASLRMFGLRVEDEGNYTCLFVTFPQGSRSVDIWLRVLAKPQNTAEVQKVQLTGEPVPMARCVSTGGRPPAQITWHSDLGGMPNTSQVPGFLSGTVTVTSLWILVPSSQVDGKNVTCKVEHESFEKPQLLTVNLTVYYPPEVSISGYDNNWYLGQNEATLTCDARSNPEPTGYNWSTTMGPLPPFAVAQGAQLLIRPVDKPINTTLICNVTNALGARQAELTVQVKEGPPSEHSGISRN

  • Protein Length

    Extracellular Domain

  • Molecular Weight

    80-105 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

PVR/CD155, a key immunoregulatory protein, is part of the poliovirus receptor family and plays a crucial role in immune modulation and cell signaling. It is expressed on various cells, including immune cells and tumor cells, where it interacts with its receptor, such as DNAM-1, leading to the activation or inhibition of T-cell responses. Research into PVR/CD155 has gained prominence due to its dual function in promoting immune evasion in tumors while also contributing to the immune response against pathogens. In the context of cancer immunotherapy, elevated levels of PVR/CD155 have been associated with poor patient outcomes, making it a potential biomarker and therapeutic target. Moreover, studies exploring recombinant PVR/CD155 proteins aim to elucidate its structure-function relationship and therapeutic potential, including the development of monoclonal antibodies that can enhance anti-tumor immunity. Understanding the molecular mechanisms of PVR/CD155 could pave the way for novel strategies to harness the immune system against cancer and improve therapeutic efficacy in combination with other immunotherapies. Thus, the research surrounding PVR/CD155 is vital for the advancement of cancer immunology and the development of effective treatments.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US