Cat: IPD-X17326

Recombinant Cynomolgus LAG-3 Protein(HEK293) , His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    LAG-3

  • 简介

    LAG-3 Protein, expressed on antigen-activated T-cells, delivers inhibitory signals by binding to ligands like FGL1. LAG-3 Protein associates with CD3-TCR, directly inhibiting T-cell activation[1][2]. LAG-3 Protein, Cynomolgus (428a.a, HEK293, His) is a recombinant protein dimer complex containing cynomolgus-derived LAG-3 protein, expressed by HEK293 , with N-8*His labeled tag. LAG-3 Protein, Cynomolgus (428a.a, HEK293, His), has molecular weight of 55-65 kDa.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Lymphocyte Activating 3; LAG3; LAG-3; CD223

  • Species

    Cynomolgus

  • Source

    HEK293

  • Tag

    N-8*His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    XP_005570011.1 (P23-L450

  • Expression Region

    P74)

  • AA Sequence

    PQPGAEISVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAPAPGHPPVPGHRPAAPYSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRATVHLRDRALSCRLRLRVGQASMTASPPGSLRTSDWVILNCSFSRPDRPASVHWFRSRGQGRVPVQGSPHHHLAESFLFLPHVGPMDSGLWGCILTYRDGFNVSIMYNLTVLGLEPATPLTVYAGAGSRVELPCRLPPAVGTQSFLTAKWAPPGGGPDLLVAGDNGDFTLRLEDVSQAQAGTYICHIRLQGQQLNATVTLAIITVTPKSFGSPGSLGKLLCEVTPASGQEHFVWSPLNTPSQRSFSGPWLEAQEAQLLSQPWQCQLHQGERLLGAAVYFTELSSPGAQRSGRAPGALRAGHL

  • Protein Length

    Partial

  • Molecular Weight

    55-65 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

LAG-3 (Lymphocyte Activation Gene-3) is an immune checkpoint receptor that plays a significant role in regulating T cell activity and maintaining immune homeostasis. It is highly expressed on activated T cells, regulatory T cells, and certain other immune cells. In cancer immunotherapy, LAG-3 has garnered considerable attention due to its ability to inhibit T cell function, making it a potential target for enhancing anti-tumor immunity. Research has shown that LAG-3 interacts with MHC class II molecules, leading to a downregulation of T cell activation and proliferation. Understanding the molecular mechanisms underlying LAG-3 signaling and its role in immune escape by tumors has become a critical focus. Additionally, the development of LAG-3-targeted therapies, including monoclonal antibodies and recombinant proteins, is being explored to improve the efficacy of existing immunotherapeutic approaches. These studies aim not only to block LAG-3’s inhibitory effects but also to use LAG-3 as a biomarker for patient stratification in immunotherapy. The exploration of LAG-3 recombinant proteins has attracted interest as tools for both studying its biology and advancing therapeutic strategies, particularly in combination with other immune modulators. Overall, ongoing research on LAG-3 continues to shed light on its dual role in immune regulation and its potential as a therapeutic target in various diseases, including cancer and autoimmune disorders.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US