Analytical Data
-
Gene name
ERMAP
- Application
-
Alternative Names
ERMAP; ERMAP_HUMAN; Erythroblast membrane associated protein ; Erythroid membrane associated protein; Erythroid membrane-associated protein; hERMAP; MGC118810; MGC118811; MGC118812; MGC118813; PRO2801
-
Species
Human
-
Source
E. coli
-
Tag
Tag Free
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96PL5
-
Expression Region
1-475aa
-
AA Sequence
MEMASSAGSWLSGCLIPLVFLRLSVHVSGHAGDAGKFHVALLGGTAELLCPLSLWPGTVPKEVRWLRSPFPQRSQAVHIFRDGKDQDEDLMPEYKGRTVLVRDAQEGSVTLQILDVRLEDQGSYRCLIQVGNLSKEDTVILQVAAPSVGSLSPSAVALAVILPVLVLLIMVCLCLIWKQRRAKEKLLYEHVTEVDNLLSDHAKEKGKLHKAVKKLRSELKLKRAAANSGWRRARLHFVAVTLDPDTAHPKLILSEDQRCVRLGDRRQPVPDNPQRFDFVVSILGSEYFTTGCHYWEVYVGDKTKWILGVCSESVSRKGKVTASPANGHWLLRQSRGNEYEALTSPQTSFRLKEPPRCVGIFLDYEAGVISFYNVTNKSHIFTFTHNFSGPLRPFFEPCLHDGGKNTAPLVICSELHKSEESIVPRPEGKGHANGDVSLKVNSSLLPPKAPELKDIILSLPPDLGPALQELKAPSF
-
Molecular Weight
52.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ERMAP (erythrocyte membrane-associated protein) is a recently identified protein that plays a crucial role in the immune system and red blood cell function. Research on ERMAP has gained momentum due to its potential implications in transfusion medicine and autoimmune diseases. Initially discovered in the context of erythrocyte functionality, ERMAP is implicated in the adhesion of red blood cells to endothelial cells, which can affect their lifespan and behavior in circulation. Furthermore, variations in ERMAP expression have been linked to hemolytic disease and transfusion reactions, making it a significant marker for compatibility testing in blood transfusions. Recent studies have indicated that ERMAP might also serve as a target for therapeutic interventions, particularly in conditions related to immune response and blood disorders. Given its pivotal role, ongoing research aims to unravel the molecular mechanisms governing ERMAP's function and its interactions within the immune landscape, paving the way for novel diagnostic and therapeutic strategies in hematology and immunology. Understanding ERMAP's full potential may ultimately enhance patient care in transfusion practices and shed light on its broader implications in health and disease.
