Analytical Data
-
Gene name
MID2
- Application
-
Alternative Names
MID2；FXY2；RNF60；TRIM1；Probable E3 ubiquitin-Protein ligase MID2
-
Species
Human
-
Source
E. coli
-
Tag
N-terminal His-Tag+TrxA
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9UJV3
-
Expression Region
532-719aa
-
AA Sequence
NSQPFKLDPKMTHKKLKISNDGLQMEKDESSLKKSHTPERFSGTGCYGAAGNIFIDSGCHYWEVVMGSSTWYAIGIAYKSAPKNEWIGKNASSW VFSRCNSNFVVRHNNKEMLVDVPPHLKRLGVLLDYDNNMLSFYDPANSLHLHTFDVTFILPVCPTFTIWNKSLMILSGLPAPDFIDYPERQECN
-
Molecular Weight
33.1kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Identification
Protein Description
MID2, or MID2 protein, has garnered significant attention in recent years due to its crucial role in various cellular processes, including the regulation of gene expression and cellular response to stress. MID2 is part of the MID family of proteins, which are characterized by their involvement in the immune response and signal transduction pathways. Research indicates that MID2 may play a pivotal role in host defense mechanisms, particularly in recognizing and responding to pathogens. The protein has been linked to the regulation of inflammation and may influence the development of autoimmune conditions. Furthermore, MID2's interactions with other molecular players in the cell highlight its potential as a therapeutic target for diseases where immune dysregulation is a factor. Recent advancements in recombinant protein technology have facilitated the production and purification of MID2, enabling detailed studies of its structure and function. Understanding the molecular basis of MID2's activity may provide insights into its role in health and disease, paving the way for novel therapeutic approaches in immunology and related fields. As researchers continue to explore the implications of MID2 in various biological contexts, its significance in therapeutic interventions becomes increasingly apparent, making it a focal point in contemporary biomedical research.
