Cat: IPD-X50114

Recombinant Mouse NMRL1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    NMRL1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Nmral1; NmrA-like family domain-containing protein 1

  • Species

    Mouse

  • Source

    E. coli

  • Tag

    N-terminal His Tag

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q8K2T1

  • Expression Region

    1-309aa

  • AA Sequence

    MADRKLVVVFGATGAQGGSVARALLEDGTFRIRVVTRNPEQRAAKELKQQGAEV VRGDQDDAASMELALAGAHATFIVTNYWETCSQDREVQQPHQWDQVFKQGKLLA DLAKRLGLHYVVYSGLENIRKLTAGKLAAGHFDGKGEVEEYFRDIGVPMTSVRL PCYFENLLSYFLPQKAADGKSFLLDLPMGDVPMDGMSVSDLGPVVLSLLKKPEE YVGQNIGLSTCRHTAEEYAALLSKHTGKAVHHAKTTPEDYEKLGFQGAQDLANM FRFYTLKPDRNIHLTLRLNPKAQTLDQWLEQHKGDFAQL

  • Molecular Weight

    37.8kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

NMRAL1, a member of the NMR family of proteins, has gained significant attention in recent years due to its potential roles in cellular processes and disease mechanisms. This protein is primarily implicated in the regulation of nitric oxide (NO) signaling and mitochondrial function, which are critical in various physiological and pathological contexts, including cancer, neurodegeneration, and cardiovascular diseases. The interest in NMRAL1 is further heightened by its involvement in the oxidative stress response and the modulation of gene expression through interactions with various transcription factors. Research has shown that NMRAL1 can influence cellular redox states, suggesting a vital role in maintaining homeostasis and cellular health. However, the molecular mechanisms underlying NMRAL1 functions remain poorly understood. Consequently, the development of recombinant NMRAL1 proteins for biochemical and biophysical studies has become essential to elucidate its structure-function relationships and to explore its potential as a therapeutic target. Recent advances in recombinant protein expression techniques have opened new avenues to investigate the detailed roles of NMRAL1 in various biological systems, enabling researchers to analyze its interactions, post-translational modifications, and effects on cellular metabolism. Understanding NMRAL1's role could provide insights into the development of novel strategies for treating diseases associated with impaired nitric oxide signaling and oxidative stress. Thus, the study of NMRAL1 recombinant proteins represents a promising frontier in both basic research and the quest for innovative therapeutic approaches.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US