Analytical Data
-
Gene name
GLP1
- Application
-
Alternative Names
GLP1；Glucagon-like peptide 1 receptor
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P01275
-
Expression Region
53-89aa
-
AA Sequence
HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA
-
Molecular Weight
30 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GLP-1 (glucagon-like peptide-1) is an incretin hormone that plays a crucial role in glucose metabolism and appetite regulation. Originally discovered in the 1980s, GLP-1 is secreted by the intestinal L-cells in response to nutrient intake and stimulates insulin secretion while inhibiting glucagon release, thereby lowering blood glucose levels. Due to its multifaceted role in glucose homeostasis and potential neuroprotective effects, GLP-1 has become a focal point in diabetes research. Recombinant GLP-1 proteins and analogs have been developed to enhance its stability and bioactivity, addressing challenges like rapid degradation in the bloodstream. These synthetic molecules, such as exenatide and liraglutide, have demonstrated efficacy in not only controlling blood sugar in Type 2 diabetes patients but also in promoting weight loss. Additionally, ongoing research is exploring their potential therapeutic benefits in other conditions, including obesity and neurodegenerative diseases. The development of GLP-1 receptor agonists marks a significant advancement in diabetes management, leading to a better understanding of metabolic disorders and opening avenues for innovative pharmaceutical interventions.
