Cat: PA1000-2166

Recombinant Human NMI Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    NMI

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    NMI;N-myc-interactor

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q13287

  • Expression Region

    62-202aa

  • AA Sequence

    EDIPETKMKFLSVETPENDSQLSNISCSFQVSSKVPYEIQKGQALITFEKEEVAQNVVSMSKHHVQIKDVNLEVTAKPVPLNSGVRFQVYVEVSKMKINVTEIPDTLREDQMRDKLELSFSKSRNGGGEVDRVDYDRQSGS

  • Molecular Weight

    51.1 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

NMI (N-myc Interactor) is a multifunctional protein that plays a critical role in various cellular processes, including transcriptional regulation, cell proliferation, and apoptosis. Initially discovered as an interactor of the N-myc oncogene, NMI has garnered significant interest due to its involvement in cancer biology, particularly in the context of neuroblastoma and other malignancies. Research indicates that NMI can modulate the activity of various transcription factors and signaling pathways, which positions it as a potential oncogenic or tumor-suppressive entity depending on the cellular context. Investigations into the structural properties of NMI have revealed the presence of specific functional domains that facilitate its interactions with other proteins and nucleic acids. Moreover, studies have suggested that dysregulation of NMI expression or function is implicated in tumorigenesis and cancer progression, making it a candidate for targeted therapies and a biomarker for various cancers. Ongoing research aims to elucidate the precise mechanisms by which NMI influences cancer cell behavior and to explore its potential as a therapeutic target, providing a deeper understanding of its role in cancer biology and enhancing the development of novel treatment strategies. Given its significant implications in cell signaling and cancer, the comprehensive study of NMI and its restructured variants could pave the way for innovative approaches in cancer therapy and precision medicine.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US