Cat: IPDX2608

Recombinant Human PIK3Cb Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    PIK3Cb

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    PI3K;PI3Kbeta;PIK3C1

  • Species

    Human

  • Source

    E. coli

  • Tag

    N-terminal His Tag

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P42338

  • Expression Region

    524-703aa

  • AA Sequence

    ANVSSRGGKKFLPVLKEILDRDPLSQLCENEMDLIWTLRQDCREIFPQSLPKLL LSIKWNKLEDVAQLQALLQIWPKLPPREALELLDFNYPDQYVREYAVGCLRQMS DEELSQYLLQLVQVLKYEPFLDCALSRFLLERALGNRRIGQFLFWHLRSEVHIP AVSVQFGVILEAYCRGSV

  • Molecular Weight

    22.3kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

PAQR5, also known as Progestin and AdipoQ Receptor Family MembeR 5, is a member of the PAQR family, which has attracted attention in recent years due to its involvement in various physiological processes and potential implications in metabolic disorders. Research has indicated that PAQR5 may play a role in mediating signaling pathways related to insulin sensitivity and adipocyte function, thus making it a significant target for studies on obesity and type 2 diabetes. Additionally, its expression has been linked to reproductive health, suggesting potential functions in hormone signaling. The recombinant expression and characterization of PAQR5 protein can provide critical insights into its structure-function relationship, facilitate the study of its molecular interactions, and aid in the development of therapeutic strategies targeting metabolic and reproductive disorders. By exploring the functional properties of PAQR5 through recombinant technologies, researchers aim to uncover its biological roles and potential as a biomarker for disease states. The elucidation of PAQR5's mechanisms may pave the way for novel treatments, especially in metabolic syndromes where traditional therapeutic approaches may fall short. Thus, the investigation of PAQR5 recombinant protein is a promising avenue for understanding complex biological processes and advancing medical science.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US